KEGG   Actinoplanes sp. SE50/110: ACPL_519Help
Entry
ACPL_519          CDS       T02044                                 

Definition
(GenBank) DNA ligase (ATP)
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ase00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    ACPL_519
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ase03400]
    ACPL_519
Enzymes [BR:ase01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     ACPL_519
DNA repair and recombination proteins [BR:ase03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     ACPL_519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEV81416
UniProt: G8SB36
LinkDB All DBs
Position
complement(473363..474268)
Genome map
AA seq 301 aa AA seqDB search
MPDRIPIRLDGHDLELSNLDKVLFPATGVTKAEVIDYYTRIAPVLLPHLRDRPVTRIRYP
NGVEGAHFFEKNKPAGTPDWVRLVTLPVPGSTKSRETVEFVVVDELATLVWLANLAAIEL
HTPQWRVGAHPDMLVVDLDPGAPAGLRECSAVAVLMRDRLAEDGIAAFPKTSGKKGMQLC
CPISGAQDAGVVSGYAKRVAEELARLVPGSITAKMAKQLRPGKIFIDWSQNNAAKTTVTP
YSLRAGPAPTASTPLTWPETEAMAIGDAEARQFTAAEALDRAQTHGDLLTGLLESGPAVP
V
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaccggatcccgatccgcctggacggccatgacctggagctgtccaacctcgac
aaggtgctgttcccggcgaccggcgtgaccaaggccgaggtgatcgactactacacccgg
atcgccccggttctgctgccgcatctgcgcgaccgcccggtcacccggatccgctatccg
aacggtgtcgagggcgcgcacttcttcgagaagaacaagccggccggcaccccggactgg
gtgcgcctggtgacgctgcccgtcccggggtccaccaagagccgggagaccgtcgagttc
gtggtcgtcgacgaactggccaccctggtctggctggccaatctggccgcgatcgagctg
cacaccccgcagtggcgggtcggtgcccacccggacatgctggtcgtcgatctggacccg
ggggcgccggccgggctgcgcgagtgttccgcggtggcggtgctgatgcgcgaccggctg
gccgaggacgggatcgccgcgttcccgaagacgtccggcaagaaggggatgcagctgtgc
tgcccgatctcgggtgcccaggacgccggggtggtctccgggtacgccaaacgggtggcc
gaggagctggcgcggctggtgccggggtcgatcaccgcgaagatggccaagcagctgcgg
ccgggaaagatcttcatcgactggagccagaacaacgcggccaagaccacggtcaccccg
tactccctgcgggccggcccggcgccgaccgcgtcgacgccgctgacctggccggaaacc
gaggcgatggccatcggggacgcggaggcccgccagttcaccgcggcggaggcgctggac
cgcgcacaaacccacggtgacctgctgaccggcctgctcgagtcgggtcccgccgtgccg
gtttga

DBGET integrated database retrieval system