KEGG   Actinoplanes sp. SE50/110: ACPL_5330Help
Entry
ACPL_5330         CDS       T02044                                 

Gene name
treS
Definition
(GenBank) maltose alpha-D-glucosyltransferase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00500  Starch and sucrose metabolism
ase01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ACPL_5330 (treS)
Enzymes [BR:ase01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ACPL_5330 (treS)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     ACPL_5330 (treS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 GHL5 hDGE_amylase
Motif
Other DBs
NCBI-ProteinID: AEV86217
UniProt: G8S5L5
LinkDB All DBs
Position
5817735..5819438
Genome map
AA seq 567 aa AA seqDB search
MVEHPSADDFGHARALPADRTWFQRAVFYEVLVRAFYDSGSDGGGDLRGLIERLDYLQWL
GVDCLWLPPFYDSPLRDGGYDIRDFYKVLPEFGTVDDFVALLDAAHKRGIRVITDLVMNH
TSDSHPWFQASRHDPDGPYGDFYVWNDTSEKYKDARIIFVDTEESNWTFDPVRRQFYWHR
FFSHQPDLNYENPAVQEAMLDVLRFWLDLGIDGFRLDAVPYLFEEEGTNCENLSQTHAFL
KHCRKVIDDEFPGRVLLAEANQWPADVVEYFGDAKSGGDECHMAFHFPLMPRIFMAVRRE
SRFPISEILAQTPAIPENCQWGIFLRNHDELTLEMVTDEERDYMYAEYAKDPRMKANVGI
RRRLAPLLENDRNQIELFTALLLSLPGSPVLYYGDEIGMGDNIWLGDRDGVRTPMQWTPD
RNAGFSTATPGRLYLPVNQDPVYGYQAVNVEAQRDSATSLLNWTRTMLAVRRRHEAFAVG
TFRELGGSNPSVLAFLREFGDDVVLCVNNLSRFPQPIELNLQHWNGYTPVELTGHVNFPR
IGQLPYLLTLPGHGFYWFQLCGSEEKQ
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atggtcgagcacccgtccgcggacgacttcggccatgcccgggcgctcccggccgaccgc
acgtggtttcaacgcgcggtcttctacgaggtgctggtccgggcgttctacgactcgggc
tcggacggcggcggcgacctgcgcggcctgatcgagcgcctggactacctgcagtggctc
ggcgtggactgcctctggctgcccccgttctacgactcgccgctgcgcgacggcgggtac
gacatccgcgacttctacaaggtgctgcccgagttcggcacggtcgacgacttcgtggcg
ctgctcgacgcggcgcacaagcgcggcatccgggtgatcaccgacctggtcatgaaccac
acgtccgactcgcacccgtggttccaggcgtcccggcacgacccggacgggccgtacggc
gacttctacgtctggaacgacaccagcgagaagtacaaggacgcgcggatcatcttcgtc
gacaccgaggagtcgaactggacgttcgacccggtccggcggcagttctactggcaccgg
ttcttctcccaccagccggacctcaactacgagaacccggccgtgcaggaggccatgctc
gacgtgctccggttctggctggacctgggcatcgacgggttccggctggacgccgtgccg
tacctgttcgaggaggaggggaccaactgcgagaacctgtcgcagacccacgccttcctc
aagcactgccgcaaggtgatcgacgacgagttccccggccgggtgctgctggccgaggcg
aaccagtggccggccgacgtggtggagtacttcggcgacgcgaagtccggtggcgacgag
tgccacatggcgttccacttcccgctgatgccgcggatcttcatggcggtgcgccgcgag
tcgcgcttcccgatctcggagatcctggcgcagaccccggccatcccggagaactgtcag
tggggcatcttcctgcgtaaccacgacgagctgaccctcgagatggtcaccgacgaggaa
cgcgactacatgtacgcggagtacgccaaggacccgcggatgaaggcgaacgtcggcatc
cggcggcggctggccccgctgctggagaacgaccggaaccagatcgagctgttcaccgcc
ctactgctgtcgctgcccgggtcgccggtgctgtactacggcgacgagatcgggatgggc
gacaacatctggctcggcgaccgcgacggcgtgcgcaccccgatgcagtggaccccggac
cgcaacgccggcttctccaccgccacccccggccggctctacctgccggtcaaccaggac
ccggtgtacgggtaccaggcggtcaacgtggaagctcagcgcgacagcgccacctcgctg
ttgaactggacccggaccatgctggcggtgcgccgccggcacgaggcgttcgccgtcggc
acgttccgggagctgggcggctcgaacccctcggtgctggcgttcctgcgcgagttcggc
gacgacgtggtgctgtgcgtcaacaacctgtcccggttcccgcagccgatcgagctgaac
ctgcagcactggaacgggtacaccccggtggagctgaccggccacgtgaacttcccgcgg
atcgggcagctgccgtacctcctgacccttccgggccacggcttctactggttccagttg
tgcgggtcggaggagaagcaatga

DBGET integrated database retrieval system