KEGG   Actinoplanes sp. SE50/110: ACPL_6055Help
Entry
ACPL_6055         CDS       T02044                                 

Gene name
pks1A
Definition
(GenBank) beta-ketoacyl synthase
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C KR PS-DH KAsynt_C_assoc PP-binding Thiolase_N adh_short Docking Erythro-docking ACP_syn_III Epimerase SAT NmrA Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AEV86942
UniProt: G8SJL5
LinkDB All DBs
Position
complement(6611689..6619950)
Genome map
AA seq 2753 aa AA seqDB search
MGDEEKLLTYLRKATAELRDARQRITELESAGTADDPVAIVAMACRYPGGVTSPEDLADL
VLDGRDAVAGFPDDRGWNVEGVYHPEPGEPGRTYTRQGAFLHDAAWFDAGFFGIGPNEAL
LMDPQQRLLLEISWEAFERAGIDPRSVRGSATGVFTGMMYHDYPEAHSTGSVASGRVSYV
FGLEGPCVTVDTACSSSLVAVHQAVQSLRTGECRLALAGGVAVMATMDTFIEFSKQRALS
ADGRCKPFAAAADGTGWGEGAGVLLLERLSDARRNGHPVLAVIRGVATNQDGASSGLTAP
NGPSQQRLIAAALADAGLTAADVDAVEGHGTGTVLGDPIEAQALLATYGADRPADRPLWL
GSLKSNIGHTQSAAAVGGIIKMVMAMRRGVLPRTLHVDAPSPKVDWSAGRVELLTEARPW
PAGERRRRAGVSSFGVSGTNAHVILEDVADEPAPDDTAPAPGIVAWPLSAASADGLRGQA
ARLAERLPDATPAAIGHALATGRAALSHRAVVVGADLPELLSGLAEVAAGEHEAGVSHDR
PAVVFTFPGQGAQWDGMAVELIETAPAFAAALERCADALAEFVDWNLLDVLRGVPGAPTF
DRVDVVQPVLWAVMVSLAELWREHGVEPAAVLGHSQGEIAAACVAGALSLADGARVVALR
SRVIATGLAGKGGMLSVPLSRAVAEQRIERFAGRLGLAAVNGPGSVVVCGEPTALDDLVA
ELTEAGLQPKRIKVDYASHSHYVAEIEAEVRAALAPVRPRPASVPFYSAVTGGLLADTTV
LDAGYWYRNLRQTVQFEDATRALLDDGHALFVECSAHPVLQVGLQDTIADAGAPAGTVES
LRRQDGGLRRFAGSLAAAWARGATVDWARFSPAARPADLPTYAFQRERYWMAPVAGADPV
SLGQQPLRHPLLGAAVPLPGTDGLVATGRVSLTSHAWLADHDALGAVLLPGTAFVELAIN
AGAQVGCGVLAELTVQAPLVLPDRGPVALQVLVGGPDEDGARPVAVHARAEGGDAPWVCH
AAGLLTPDDGGPAPGHPDDSWPPAGAVAVDVTGAYDGLLGRGYAYGPVFQGLRALWRRGD
EVYAEVALPEPAHADAALFGLHPAALDAALHAALLTSDPDGTVLPFAWTGVRLHATGATE
LRVRLAPAGTGSSIHLTDPAGRPVLSADGLVSRPVSAEQLAAPGAPRDVPYRLDWMPMPA
AGTAPPVRWREVGGLDELTGDDDLPDVVLLRAPAADPADLPAALRETGAATLATLRRWLS
EPALDGRRLALLVEPDTLLGDTVRGMLRAAQAEHPDTFLVLDHDGRPESLAALPDALAAG
EPEVSIRSGRPHLPRLVAAGPPDAAARPDPAGTVLVTGGTGGLGALVARQLTTDCGVRHL
LLTSRRGPAAPGAEELVAELTERGVQVTVAACDAGDRAALAAVLAAVPAEHPLTGVVHAA
GVLDDGLIAAQTPERLDAVLRAKADGAWHLHELTADADLAMFVLFSSVAATLGGPGQTTY
AAANGFLDALAAHRRAAGLPATAMAWGLWTGAGMGDRLREADVRRMAADGLPPLPVADGL
TLFAAALRTDAGHQALLRLDPVVLRAQAAAGELHPKLRALIRVPARRAAGETSLPRRLAG
LGRPERLALLADEVRRRAAAVLGFTDPAGVDPGRAFRELGFDSLASLQLRNALNALTGLR
LPATLVFDHPSCAAVAGHLDELLMGAATADDRAGDRVATADGEPIAIVGIGCRFPGGARG
PAGLWRIVDEGADVIAGLPADRGWDLDNGYHPEPGTPGRHYARGGGYLHDAAEFDAEFFG
ISPAEALTMDPQQRLLLEVSWEALEHAGIDPATLAGTDTGVFAGLMYHDYPLNTATGSIA
SGRLAYTYGFEGPAVTVDTACSSSLVAVHLAVQALRRGECGLALAGGATVMSTTETLVDF
SMQAGLSPDGRCRSFAAGADGTGFAEGAGLLVLERLADARRHGHPVLALISGTAINQDGA
SNGLTAPNGLAQQRVIRAALADARLTAADVDVVEAHGTGTVLGDPIEANALLATYGRDRP
ADRPVRLGSIKSNIGHAQAAAGVAGVIKMVEALRHDTLPRTLHAVQPSPHVDWDAGAMRL
LTEPAAWPGGDRPRRAAVSSFGISGTNAHLILTEPPAAAPAEAPVAAGAPVVPWLLSARS
PQALREHAAGIARVAAGLRPADVAATLARRAALPHRAVLAVADPAEGIAALTALAAGDPA
APPVETAATATGCVFLFTGQGAQRLGMGRGLYERFPVFAGAFDEVLAGLVPGLRDVMWGG
DAAALDRTGHAQGALFAVEVALFRLVESWGVVPAAVAGHSIGEVAAAHVAGVLSLSDACA
LVVARSRLMQALPVGGAMTVVEASEAEIGPYLGRVDLAAVNGLTSVVVSGAADAVAEVAA
VFAGRGRRTRALRVSHAFHSAHMDPMLDDLRDVAAGLEAAAPRIPLLSTLTGRWATAEDI
TTAGYWARQVREPVRFHDAVVALAATGARVALELGPDAVLAGLGPHCVPDSDLDFLPTLR
RDRDEERALVTAVTAAHARGVPMDRAALLAGTGGVPVDLPTYPFQRRTYWLTAGDSSGIA
ALAGAVDSGDDAFDAGLPAMIAGQSPAQRHLTLVDMVRVHAAAVLGHPDVAAVPIDRPLQ
ELGFDSMAAVSLRRRLTAATGLTLPSTLAFDHPTCEAAARFLATRLAEEREPDEALATVV
RLETLLADTTPTAEVTARLEALLRTWNDRAATGGDGLSDEELFARLDREYGGV
NT seq 8262 nt NT seq  +upstreamnt  +downstreamnt
gtgggcgacgaggaaaagctcctaacgtatctgcggaaggccaccgccgagttgcgggac
gcccgtcagcgcatcaccgaactggagtcggccggcaccgccgacgatccggtcgcgatc
gtcgcgatggcgtgccgctacccgggcggggtcacctccccggaggacctcgccgacctg
gtgctcgacggccgggacgcggtcgccggcttccccgacgaccgcggctggaacgtggag
ggcgtctaccaccccgagccgggggagccgggccggacgtacacccggcagggtgccttc
ctgcacgacgccgcctggttcgacgccggcttcttcgggatcggcccgaacgaggcgctg
ctgatggacccgcagcagcggctgctgctggagatctcgtgggaggccttcgaacgggcc
gggatcgacccccggtcggtgcgcggcagcgcgaccggggtgttcaccggcatgatgtac
cacgactatccggaggcgcacagcaccggatcggtcgcctccgggcgggtgtcgtacgtg
ttcgggctggagggcccgtgcgtcaccgtcgacaccgcctgctcctcctcgctggtcgcc
gttcaccaggcggtccagtcgctgcgcaccggggagtgccggctggcgctggccggcggg
gtggcggtgatggccaccatggacaccttcatcgagttcagcaagcagcgggcgctgtcc
gcggacggccggtgcaagccgttcgcggctgccgccgacggcaccggctggggcgagggc
gccggggtgctgctgctggaacggctctccgacgcccgccgcaacggccacccggtgctc
gccgtgatccgcggcgtcgccaccaaccaggacggcgccagcagcgggctgaccgccccg
aacgggccgtcgcagcagcgcctgatcgccgccgcgctggccgacgccggcctgaccgcg
gccgacgtggacgcggtcgaggggcacggcaccggcaccgtgctgggcgacccgatcgag
gcgcaggcgctgctcgccacgtacggcgcggaccggcccgcggaccgcccgctctggctc
ggctcgctcaagtcgaacatcgggcacacccagtcggccgccgcggtcggcggcatcatc
aagatggtcatggcgatgcgccgcggcgtgctgccccgcaccctgcacgtcgacgcgccg
tcacccaaggtggactggtccgccggacgggtcgagctgctcaccgaggcccgtccgtgg
ccggcgggggagcgccgccgccgggccggggtgtcctcgttcggggtgagcggcacgaac
gcgcacgtcatcctggaggacgtcgccgacgagccggcgcccgacgacacggcgccggca
ccgggaatcgtcgcctggccgctgtccgcggccagcgccgacgggctgcgcggccaggcc
gcccggctggccgagcggctccccgacgccaccccggccgcgatcggccacgccctggcc
accggccgggccgcgctgtcgcaccgcgccgtggtggtcggcgccgacctgcccgagctg
ctgtccggcctggccgaggtggccgccggggagcacgaggcgggggtcagccacgaccgg
cccgcggtggtgttcaccttccccggccagggcgcgcagtgggacggcatggcggtcgag
ctgatcgagaccgccccggccttcgccgcggccctggagcgctgcgccgacgcgctcgcg
gagttcgtcgactggaacctgctcgacgtgctgcgcggcgttcccggcgcgcccaccttc
gaccgggtcgacgtggtccagccggtgctctgggcggtcatggtgtcgctcgccgagctg
tggcgcgagcacggcgtcgagccggccgccgtgctcggccactcgcagggcgagatcgcc
gcggcctgcgtggccggcgccctgtcgctggccgacggcgcgcgcgtggtggccctgcgc
agccgggtgatcgcgaccgggctggccggcaagggcggcatgctgtccgtgccgctctcc
cgggcggtcgccgaacagcgcatcgagcggttcgccggccggctgggcctggccgcggtc
aacggccccggctcggtggtggtctgcggcgaaccgaccgccctcgacgacctggtcgcc
gagctcaccgaggccgggctgcaaccgaaacggatcaaggtcgactatgcgtcgcactcg
cactacgtggcggagatcgaggcggaggtccgggcggcgctggccccggtgcggccccgg
ccggcgagcgtcccgttctactccgcggtcaccggcggcctgctcgccgacaccaccgtg
ctcgacgccgggtactggtaccgcaacctgcgccagaccgtgcagttcgaggacgccacc
cgggcgctgctggacgacgggcacgcgctgttcgtcgagtgcagcgcccacccggtgctg
caggtcggcctgcaggacaccatcgccgacgcgggcgcaccggccggcaccgtggagtca
ctgcgccgccaggacggcgggctgcgccggttcgccggttcgctggccgccgcctgggcg
cgcggtgcgacggtcgactgggcgcggttctcgcccgcggcccggcccgccgacctgccc
acctacgcgttccagcgggagcggtactggatggcgccggtggccggcgccgacccggtg
tcgctgggccagcagccgctgcgtcacccgctgctgggcgccgcggtcccgctgcccggc
accgacggcctggtcgccaccggccgggtgtcgctgacctcgcacgcctggctggccgac
cacgacgcgctcggcgccgtgctgctgcccggcaccgcgttcgtcgagctggcgatcaac
gccggcgcccaggtcggctgcggggtgctcgccgagctgaccgtgcaggccccgctggtg
ttgccggaccgtggtccggtggcgctgcaggtgctggtcggcgggccggacgaggacggt
gcccgcccggtcgcggtgcacgcccgcgccgagggcggcgacgccccgtgggtctgccac
gcggccggcctgctcaccccggacgacggtgggccggccccgggtcacccggacgacagc
tggccgccggccggcgcggtcgccgtcgacgtcaccggagcctacgacgggctgctcggg
cgcggctacgcgtacgggccggtcttccagggcctgcgggcgctgtggcggcgcggcgac
gaggtgtacgccgaggtcgccctgcccgagccggcgcacgccgacgccgcgctgttcggc
ctgcacccggccgccctggacgcggccctgcacgccgccctgctcacctccgacccggac
ggcacggtgctgccgttcgcctggaccggcgtccggctgcacgccaccggcgccaccgag
ctgcgggtccggctcgccccggccggcaccggctcgtcgatccacctcaccgatccggcc
ggccggccggtgctctccgcggacggcctggtcagtcggccggtctcggccgagcagctg
gccgcgcccggtgcgccgcgggacgtcccgtaccggctggactggatgccgatgccggcg
gccgggaccgcgccgccggtccgctggcgggaggtcggcggcctcgacgagctgaccggc
gacgacgatctgcccgacgtggtgctgctgcgcgcgcccgccgccgacccggccgatctg
ccggccgcactgcgcgagaccggcgccgcgaccctggccacgctgcgccgctggctttcc
gaaccggcgctggacggccgccggctggccctgctggtcgagccggacacgctgctcggc
gacacggtccgcggcatgctgcgcgccgcccaggcggagcacccggacaccttcctggtg
ctcgaccacgacgggcgtcccgagtcgctggccgccctgccggacgcgctggccgccggc
gagcccgaggtgtccatccggtccggccgcccgcacctgccgcggctggtcgccgccggt
ccgccggacgccgctgcgcggccggatccggcgggcacggtgctggtcaccggcggcacc
ggcggtctcggtgcgctggtggcacggcagttgaccaccgattgcggcgtacggcatctg
ctgctcaccagtcgccgaggacccgccgccccgggtgccgaggagctggtcgccgaactg
accgagcggggcgtccaggtgaccgtggccgcgtgcgacgccggcgaccgggccgcgctg
gccgccgtgctcgccgcggtgcccgccgagcacccgctgaccggtgtggtgcacgccgcc
ggggtgctcgacgacggcctgatcgcggcgcagaccccggagcgactggacgcggtgctg
cgcgccaaggccgacggcgcctggcatctgcacgagctcaccgccgacgccgacctggcg
atgttcgtgctcttctcctccgtcgccgcgaccctgggcggcccggggcagaccacctac
gcggccgccaacggcttcctcgacgcgctcgccgcgcatcgccgcgcggccgggctgccg
gccaccgcgatggcctggggcctgtggaccggcgccgggatgggtgaccggctgcgcgag
gccgacgtgcggcggatggcggccgacggcctgcccccgctgccggtcgccgacggcctg
acactgttcgccgccgcgctgcgcaccgacgccggccaccaggcgctgctgcggctggac
ccggtggtgctgcgcgcccaggccgccgccggcgagctgcaccccaagctgcgcgcgctg
atccgggtgccggcccggcgcgcggccggcgagacgtccctgccccggcggctggccggg
ctgggccgcccggagcggctcgcgctgctcgccgacgaggtgcgccggcgggccgccgcc
gtgctcggcttcaccgacccggccggggtcgacccgggccgggccttccgggagctcggc
ttcgactcgctggcctcgctgcagctgcgcaacgcgctgaacgcgctgaccgggctgcgc
ctgccggccaccctggtcttcgaccacccgtcctgcgccgcggtcgccgggcacctcgac
gagctgctgatgggcgccgccaccgcggacgaccgcgcgggggaccgggtggcgaccgcg
gacggcgagccgatcgcgatcgtcgggatcggctgccggttccccggcggcgcccgtggc
ccggccgggctgtggcggatcgtcgacgagggcgccgacgtgatcgccggcctgcccgcc
gaccgtggctgggacctggacaacggttaccacccggagcccggcacgccgggccggcac
tacgcccgcggcggcggatacctgcacgacgcggccgagttcgacgccgagttcttcggg
atcagcccggccgaggcgctcaccatggacccgcagcagcggctgctgctggaggtctcc
tgggaggccctggagcacgccggcatcgacccggccacgctggccggcaccgacaccggg
gtgttcgccggcctgatgtaccacgactacccgctgaacaccgcgaccggctcgatcgcc
tccggccgcctcgcctacacctacggcttcgagggcccggccgtcaccgtcgacaccgcc
tgctcgtcgtcgctggtcgcggtccacctcgcggtgcaggcgctgcgccgcggcgagtgc
gggctggctttggccggcggcgcgaccgtgatgtcgacgaccgagaccctggtcgacttc
agcatgcaggccggcctgtcgccggacgggcgctgccgctcgttcgccgccggggccgac
ggcaccggtttcgccgagggcgccggcctgctcgtgctggaacgcctcgccgacgcccgc
cgccacggccacccggtgctcgccctgatctccggcacggcgatcaaccaggacggcgcg
tccaacgggctgaccgccccgaacggcctcgcccagcagcgggtgatccgcgcggcgctg
gccgacgcccggctcaccgcggccgacgtcgacgtggtcgaggcgcacggcaccggcacc
gtcctgggcgacccgatcgaggcgaacgcgctgctcgccacgtacggccgggaccgtccc
gcggaccggccggtgcgcctcggctcgatcaagtcgaacatcgggcacgcccaggcggcc
gccggagtggccggcgtgatcaagatggtcgaggcgctgcggcacgacacgctgccgcgc
accctgcacgccgtgcagccgtccccgcacgtcgactgggacgccggcgcgatgcggctg
ctcaccgagccggccgcgtggccgggtggggaccggccgcggcgcgccgcggtctcctcg
ttcgggatcagcggcaccaatgcccacctgatcctgaccgagccgccggccgccgcgccg
gcggaggcaccggtcgccgccggtgccccggtggtgccgtggctgctgtccgcccgcagc
ccgcaggcactgcgcgagcacgccgccgggatcgcccgggtggcggccgggctgcggccc
gccgacgtcgccgcgaccctggcccgccgggcggcgctgccgcaccgggcggtcctggcc
gtcgccgacccggccgaggggatcgcggcactgaccgcgctcgccgccggcgacccggcc
gcgccgccggtcgagaccgctgccaccgccaccggctgcgtcttcctgttcaccggtcag
ggtgcgcagcgtctggggatgggtcgtgggttgtacgagcggttcccggtgttcgcgggt
gcgttcgatgaggtgttggcggggttggtgccggggttgcgggacgtgatgtggggtggt
gacgcggcggcgttggatcggacgggtcatgcgcagggtgcgttgttcgccgtcgaggtg
gcgttgttccggctggtggagtcgtggggtgtggtgcctgcggcggtggctggtcattcg
atcggtgaggttgctgcggcgcatgtggcgggggtgttgtcgctgtcggatgcgtgtgcg
ttggtggtggctcggagccggttgatgcaggcgttgccggtgggtggggcgatgacggtc
gtcgaggcttcggaggcggagatcgggccgtatctgggtcgggtcgatctggccgcggtc
aacgggctcacctcggtcgtggtctccggtgcggcggatgcggtggcggaggtggccgcg
gtcttcgcgggccggggccgccgtacccgcgcgctgcgggtctcgcacgccttccactcc
gcccacatggacccgatgctggacgacctgcgcgacgttgccgccggactggaggcggcc
gccccgcggatcccgctgctgtcgacgctcaccggacgctgggcgacggccgaggacatc
accaccgccgggtactgggcgcggcaggtccgcgagccggtccggttccacgacgcggtg
gtggcgctggccgcgaccggcgcccgggtggcgctcgaactcggcccggacgcggtcctc
gccgggctggggccgcactgcgtaccggacagcgatctggacttcctgcccaccctgcgg
cgggaccgggacgaggagcgggccctggtcaccgcggtcaccgcggcacacgcccggggt
gtcccgatggaccgggccgcgttgctggccgggaccggcggcgtgccggtcgacctgccc
acctacccgttccagcgccggacctactggctgaccgccggggacagctccgggatcgcc
gcgctggccggcgcggtcgacagcggggacgacgcgttcgacgccggactgcccgcgatg
atcgccgggcagagcccggcccagcggcacctgaccctggtcgacatggtccgggtgcac
gccgccgcggtgctcgggcaccccgacgtggctgcggtgccgatcgaccggccgctgcag
gaactgggcttcgactcgatggccgcggtgtcgctgcgccgccggctgaccgccgcgacc
ggcctcaccctgcccagcaccctggccttcgaccaccccacctgcgaggcggcggcccgg
ttcctggccacccggctggccgaggagcgggaaccggacgaggcgctggcgaccgtggtg
cggctggagacgctgctggccgacactaccccgaccgccgaggtcaccgcacgcctcgag
gcgctgctgcggacctggaacgaccgggccgccaccggcggcgacgggctcagcgacgag
gaactgttcgcccggctcgaccgggaatacgggggcgtctga

DBGET integrated database retrieval system