KEGG   Actinoplanes sp. SE50/110: ACPL_6737Help
Entry
ACPL_6737         CDS       T02044                                 

Gene name
pkaA
Definition
(GenBank) serine/threonine protein kinase, bacterial
Organism
ase  Actinoplanes sp. SE50/110
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Pkinase_fungal Kinase-like Pox_ser-thr_kin
Motif
Other DBs
NCBI-ProteinID: AEV87619
UniProt: G8S922
LinkDB All DBs
Position
complement(7405228..7406682)
Genome map
AA seq 484 aa AA seqDB search
MQDSTDSEPLAGRSVGNSYRLVKPIGQGATGTVWEGEDSTTGEPVAVKLLHESLLRQPRL
VTRFVQERTILLMLRHRNVVRVRDLFSVGETLGLVMDLVAGGSLRDHLHRERTLAPAEAV
RLAAQVADALAEAHDLGIIHRDLKPDNILVLERNGRLETRLTDFGIARILNVPSMTTPNA
VVGTPHYMAPEAFHGVTPSPATDVYALGVLLYELVSGQPPYLSDSVPELMRMHAEGRPKR
RPGIPDDLWRLIRGCLSAKPRQRPAAAALVRELRELNRKLAGIAPLPPPAPPSLPPADPD
DRAVDPPELRDGIRLPRAVAQARRPRNAAPGHRWVRSSAAVRGPRRGAARRRRRRLDLAA
RRHPGLAVGAAQPPRAGRLGPGRPAPKGRFLHETCETFPRTYETGRPAAPTPAGGRGAGP
VGVRARPHDRPGHPQSARPEAVPVDRPDRAVPGVPHRAGRRPRAHRGDVARRGHRSYRGR
PHHL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcaggattcgaccgacagcgagccactggccggacggagtgtcggcaattcgtaccgg
ctcgtcaagccgatcgggcagggcgccaccggaacggtgtgggagggcgaggacagcacc
accggggaaccggtcgccgtcaaactcctgcacgagagcctgctccggcagccccggctg
gtcacccgcttcgtccaggaacgcaccatcctgctcatgctccgacaccgcaacgtggtc
cgggtccgcgacctgttcagcgtcggcgagaccctcggcctggtgatggacctggtggcc
ggcggcagcctgcgcgaccacctgcaccgcgaacgcaccctggcgccggccgaggcggtg
cggctcgccgcgcaggtcgccgacgccctcgccgaggcgcacgacctcgggatcatccac
cgcgacctcaaaccggacaacatcctggtgctcgaacgcaacggccggctggagacccgg
ctgaccgacttcggcatcgcccggatcctcaacgtgccgagcatgaccaccccgaacgcg
gtcgtcgggaccccgcactacatggcgccggaggcgttccacggggtcacccccagcccg
gccaccgacgtctacgcgctcggcgtgctcctctacgagctggtctccgggcagccgccg
tacctcagcgactccgtcccggaactgatgcgcatgcatgccgagggtcgtccgaaacgt
cgccccggcatccccgacgacctgtggagactcatccgcggatgcctctcggcgaagccc
cggcagcgtccggcggccgccgctctcgtgcgtgagctgcgcgaactcaaccgcaaactg
gccggaatcgcgccgctgccgccgcccgcgccgcccagcctgccgcccgccgacccggac
gaccgggcggtcgacccgccggaactgcgcgacggcatccggctgccgcgcgccgtcgcg
caggcccgccgcccgcgcaacgccgcaccgggccatcgatgggtgcggtccagcgcggcg
gttcgcggtcctcgccggggtgctgctcgccgccggcgtcgccggctcgatctggcggca
cggcggcaccccggcctcgccgtcggcgctgcccagccaccccgcgccggccgcctcggt
ccaggtcgtcccgcgccgaaaggtcgtttcctccacgaaacctgcgaaaccttcccgcgt
acgtacgaaacgggccgtccagccgcgcccaccccagccggaggacgaggtgcggggccc
gtgggagtgcgcgcccggcctcatgatcgacctggccacccgcagtccgctcgccccgaa
gccgtgccagtcgatcggccggaccgtgcagttccaggcgtccctcaccgcgccggccgg
cggccgcgcgcacatcgaggtgacgttgcgcgacgcggacaccggtcgtaccgtggccgg
ccccaccacctgtga

DBGET integrated database retrieval system