KEGG   Actinoplanes sp. SE50/110: ACPL_7553Help
Entry
ACPL_7553         CDS       T02044                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
ase  Actinoplanes sp. SE50/110
Brite
KEGG Orthology (KO) [BR:ase00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ACPL_7553
Enzymes [BR:ase01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ACPL_7553
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni Phage_clamp_A
Motif
Other DBs
NCBI-ProteinID: AEV88433
UniProt: G8S0C5
LinkDB All DBs
Position
8352770..8353174
Genome map
AA seq 134 aa AA seqDB search
MRLPRFLMPRTVVSAHCDLPCGVYDPAQARIEAESIKAIAEKYAANTDPEFRTRAILIKE
QRAELVKHHLWVLWTDYFKAPHFEKYPNLHQLFNEATKLAGASGAKGSVDVAVADQLLGK
IEEISKIFWETKQA
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgcgacttccgcgtttcctgatgccgcgcaccgtggtcagcgcgcactgcgacctgccc
tgcggcgtctacgacccggcccaggcccggatcgaggccgagtcgatcaaggccatcgcc
gagaagtacgcggcgaacacggaccccgagttccgcacccgggccatcctgatcaaggag
cagcgcgccgagctggtcaagcaccacctctgggtgctgtggaccgactacttcaaggcc
ccgcacttcgagaagtacccgaacctgcaccagctcttcaacgaggccaccaagctcgcc
ggcgcgtccggcgccaagggctcggtcgacgtcgcggtcgccgaccagctgctcggcaag
atcgaggagatctccaagattttctgggagaccaagcaggcctga

DBGET integrated database retrieval system