KEGG   Actinoplanes sp. SE50/110: ACPL_900Help
Entry
ACPL_900          CDS       T02044                                 

Gene name
icdA
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
ase  Actinoplanes sp. SE50/110
Pathway
ase00020  Citrate cycle (TCA cycle)
ase00480  Glutathione metabolism
ase01100  Metabolic pathways
ase01110  Biosynthesis of secondary metabolites
ase01120  Microbial metabolism in diverse environments
ase01130  Biosynthesis of antibiotics
ase01200  Carbon metabolism
ase01210  2-Oxocarboxylic acid metabolism
ase01230  Biosynthesis of amino acids
Module
ase_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ase_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:ase00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACPL_900 (icdA)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACPL_900 (icdA)
Enzymes [BR:ase01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     ACPL_900 (icdA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh Phe_ZIP
Motif
Other DBs
NCBI-ProteinID: AEV81797
UniProt: G8SIJ9
LinkDB All DBs
Position
889087..890301
Genome map
AA seq 404 aa AA seqDB search
MAKIKVKNPVVEIDGDEMTRIIWKQIREQLIQPYLDVNLEYYDLGIQYRDETDDQVTIDA
ANAIKRHGVGVKCATITPDEARVQEFGLKKMWRSPNGTIRNILGGVVFREPIIMKNVPRL
VPGWTKPIVIGRHAHGDQYKASDFVAPSKGKMTVTFTPEDGSAPIEMHVADFPAGGVGMA
MYNFDESIRDFARASLRYGLARNYPVYLSTKNTILKAYDGRFKDLFAEIFETEFADQFKE
AGITYEHRLIDDMVAAALKWEGGYVWACKNYDGDVQSDTVAQGFGSLGLMTSVLMTPDGQ
TVEAEAAHGTVTRHYRQWQKGEKTSTNPIASIFAWTGGLKHRGKLDGTPEVTQFAEALEQ
VCIETVEGGQMTKDLALLISKDAPWLSTDEFMNALDENLARKLA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaatcaaggtcaagaacccggtcgtggagatcgacggcgacgagatgacccgg
atcatctggaagcagatccgggagcagctgatccagccctacctcgacgtcaacctcgag
tactacgacctcggcatccagtaccgggacgagaccgacgaccaggtgacgatcgacgcg
gcgaacgcgatcaagcggcacggcgtcggcgtcaagtgcgccaccatcaccccggacgag
gcgcgggtgcaggagttcggcctgaagaagatgtggcggtcgccgaacggcacgatccgc
aacatcctcggcggcgtcgtcttccgtgagccgatcatcatgaagaacgtgccccggctg
gtacccggctggaccaagccgatcgtcatcggccgtcacgcccacggcgaccagtacaag
gccagcgacttcgtggcgcccagcaagggcaagatgaccgtcaccttcaccccggaggac
ggttccgcgccgatcgagatgcacgtggccgacttcccggccggcggcgtcggcatggcc
atgtacaacttcgacgagtcgatccgcgacttcgcgcgcgcctcgctgcgctacggcctg
gcccgcaactacccggtctacctgtccaccaagaacaccatcctgaaggcgtacgacggc
cgcttcaaggacctgttcgcggagatcttcgagaccgagttcgccgaccagttcaaggag
gccgggatcacctacgagcaccggctgatcgacgacatggtcgcggccgcgctcaagtgg
gagggcggctacgtctgggcgtgcaagaactacgacggtgacgtgcagtcggacacggtc
gcgcagggcttcggctcgctcggcctgatgacgtcggtgctgatgaccccggacggccag
accgtcgaggccgaggcggcgcacggcacggtcacccggcactaccggcagtggcagaag
ggcgagaagacgtcgaccaacccgatcgcgtcgatcttcgcgtggacgggcgggctcaag
caccgcggcaagctggatgggacgccggaggtcacccagttcgccgaggctctggagcag
gtctgcatcgagaccgtcgagggcggtcagatgaccaaggacctcgcgctgctgatcagc
aaggacgcgccgtggctgtcgaccgacgagttcatgaacgcgctcgacgagaacctggcg
cgtaagctcgcctga

DBGET integrated database retrieval system