KEGG   Aggregatibacter segnis: NCTC10977_01784Help
Entry
NCTC10977_01784   CDS       T06075                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase [NADH] FabI
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
aseg  Aggregatibacter segnis
Pathway
aseg00061  Fatty acid biosynthesis
aseg00780  Biotin metabolism
aseg01100  Metabolic pathways
aseg01130  Biosynthesis of antibiotics
aseg01212  Fatty acid metabolism
Module
aseg_M00083  Fatty acid biosynthesis, elongation
aseg_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:aseg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    NCTC10977_01784 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NCTC10977_01784 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    NCTC10977_01784 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:aseg01004]
    NCTC10977_01784 (fabI)
Enzymes [BR:aseg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     NCTC10977_01784 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     NCTC10977_01784 (fabI)
Lipid biosynthesis proteins [BR:aseg01004]
 Fatty acid synthase
  Component type
   NCTC10977_01784 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short DUF4570
Motif
Other DBs
NCBI-ProteinID: SQH65215
LinkDB All DBs
Position
1:1830885..1831673
Genome map
AA seq 262 aa AA seqDB search
MGFLTGKRILVTGLASNRSIAYGIAKAMKEQGAELAFTYLNEKLQPRVEEFAKEFGANIV
LPLDVATDESIQNCFAELSKHWNKFDGFVHAIAFAPGDQLDGDYVNAATREGYRIAHDIS
AYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAKASLEAATRVMAADLGKD
GIRVNAISAGPIRTLAASGIKNFKKMLATFEKTAALRRTVTIEDVGNSAAFLCSDLASGI
TGEIVHVDAGFSITAMGELGEE
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggtttcttaacaggtaaacgtattttagtcacaggtctcgccagcaatcgttctatc
gcctacggcatcgcaaaagcgatgaaagagcaaggcgcagaattagcgttcacttattta
aatgaaaaattacaaccgcgtgttgaagaatttgccaaagaattcggcgcaaacatcgtt
cttccattagacgttgctactgatgaaagcattcaaaactgtttcgcagaattaagcaaa
cattggaataaattcgatggtttcgtacacgctatcgcattcgcaccgggcgatcaatta
gacggcgactatgtgaatgcggcaacccgcgaaggttatcgcattgcccacgacatcagc
gcatacagcttcgtggcaatggcgcaagcggcacgtccatatttgaatcctaacgcagca
ttattaaccctttcttacttaggtgcagaacgtgccattccaaactacaacgtgatgtgt
ttagccaaagcctctcttgaagcggcaacccgtgtgatggcagctgatttaggcaaagac
ggcattcgtgtgaacgccatttctgcaggcccgattcgtaccttagcggcttccggcatt
aaaaacttcaagaaaatgttggcaaccttcgagaaaaccgctgcattacgccgtaccgtg
actatcgaagatgtaggcaactccgcagcgttcttatgctctgatttagcctccgggatc
accggtgaaatcgtccatgttgatgcaggcttcagcatcaccgccatgggcgaactaggc
gaagaataa

DBGET integrated database retrieval system