KEGG   Candidatus Arthromitus sp. SFB-mouse-Japan: SFBM_0372Help
Entry
SFBM_0372         CDS       T01591                                 

Definition
(GenBank) calcium-transporting ATPase
  KO
K01537  Ca2+-transporting ATPase [EC:3.6.3.8]
Organism
asf  Candidatus Arthromitus sp. SFB-mouse-Japan
Brite
Enzymes [BR:asf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.8  Ca2+-transporting ATPase
     SFBM_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase_N Cation_ATPase
Motif
Other DBs
NCBI-ProteinID: BAK56151
UniProt: F9VIN9
LinkDB All DBs
Position
complement(409081..411666)
Genome map
AA seq 861 aa AA seqDB search
MWHSKSIEDISKTLNTNIKTGLSNSCASKLLNENGKNELTEGSKRSLIKLIFDQINNILV
YILILTGIISFFLGEPEESIIIFIVIILNATIGIIQENKAEKSLEALKNLSSPKAIVKRD
NKIIEISSKDLVVGDIIILDAGRIIPADIRFFECVNLKVDESALTGESLPTEKNTNIISN
NESIPIADRKNIGYMSTIVTYGRGEGIVVSTGMNTEIGKIASFLNNSKNELTPLQKKLNI
LGKNIGILTIIICIIIMIVGLIQGNKLFDIFFIAISLAVAAIPEGLSTIVAIVLALGVQK
MIKKNAIIRKLSSVETLGSVNIICSDKTGTLTVNKMTVIEYFINNSKFDAREFKNDDNTK
KLFIRSMTLCNDASYSNDEEVGDPTEIALLKFAGKNIENDTFKRIREIPFDSDRKLMTTV
NNIHDIFYSFTKGALDNLLNLCDKISIKGEIVELTDDIRNNILNTAEEMANSALRTLAFA
YKEIINLTKDNYENNLIFLGMVGMIDPPRKEVKQSIEIAKRSGIKTIMITGDHKNTAFAI
GKELNIANDISETMLGSEIDKLTDDELNNKIKNVTIFARVSPEHKVKIVRALKSVGNIVS
MTGDGVNDAPSLKMADVGIAMGITGTDVCKNASDIILTDDNFKTIITAVEEGRNIFNNIK
KSIIFLLTCNLGEILTIFISILFKFPVPLSPIHLLWINLITDSLPALSLGVDTYDKNIMN
NKPRKGNKNLISKSNIIKLILNGFIIGIVSITSFLTRYKKVNLIYAQSMAFIVLSFSQLF
LSLSIRSEKEYLFKIGLFSNMKLIYSILLGVIIQIILIKIPSFNSFFNTQNLSTNDWIIS
IILSLIPFIISELLKAFTHKK
NT seq 2586 nt NT seq  +upstreamnt  +downstreamnt
atgtggcactcaaaatcaattgaagatatatcaaaaaccctaaatacaaatataaaaaca
ggcctatctaactcctgtgcctctaaacttttaaatgaaaatggtaaaaacgaattaact
gaagggtcaaagaggagcctaatcaaacttatatttgatcaaataaataacattttagtc
tacattttaatactaactggtataatatcatttttcctcggagagcctgaagaaagtata
ataatattcattgttattatcttaaacgcaactataggaatcatccaagaaaataaagct
gaaaagtcccttgaagcattaaaaaatctatcatctccaaaagctattgttaaacgtgat
aataaaattattgaaataagttcaaaagatttagtggttggagacattattatacttgat
gctggcagaataatacctgctgatattagattctttgaatgtgtgaatcttaaagttgat
gaatctgccctaactggcgaatctcttccaacagaaaaaaacactaatataatctcaaat
aatgaatctatcccaatagcagatagaaaaaatataggatatatgtcaactatagttaca
tatggacggggagaaggaattgtagtttcaacaggaatgaacacagagataggtaaaata
gcctcttttctaaataactcaaaaaatgaacttacacccctccaaaaaaaattaaatatc
cttgggaaaaatattggaattcttacaattataatatgtattatcattatgattgttggg
cttatacaaggtaataaattatttgatatattcttcatcgcaatatctttagctgtagct
gccatacccgaaggtctttctactattgttgctatagttttagctcttggagtacaaaag
atgatcaaaaaaaatgcaatcataagaaagctctcatctgttgaaaccttaggatctgtc
aatattatttgttcagataaaactggaacacttaccgtaaataaaatgacagttatagaa
tatttcataaataattcaaagtttgacgctcgagagtttaaaaatgatgataacaccaaa
aaattatttataagaagtatgactctatgtaatgatgcaagttactctaacgatgaagag
gtaggtgatcctacagaaattgcacttcttaaattcgctggcaaaaatatagaaaatgat
accttcaaaagaatacgagagataccatttgactccgatagaaaattaatgactacagta
aacaatattcatgatattttctactcatttacaaaaggggcactcgataatcttcttaat
ctatgtgataaaatttccataaaaggtgaaatcgtagaattaactgatgatataagaaac
aacatactaaatacagccgaagaaatggcaaatagtgcattaagaacccttgcatttgca
tacaaagaaattataaatttaactaaagataattatgaaaataacctaatattccttgga
atggttggaatgatcgatcctcctagaaaagaggtcaaacaatccatagaaattgcaaaa
agatcaggaataaaaacaattatgattaccggtgatcataaaaatacagcttttgccatt
ggcaaagaacttaatatagccaatgatattagtgagactatgcttggatctgaaatagat
aaactaacagatgatgaattaaataataaaattaaaaacgtaactatatttgcgcgggtt
tctccagaacataaagttaagatcgttagggctctaaaatcagttggaaatatagtatct
atgactggagatggagtaaatgatgcaccttcacttaaaatggccgatgttggtatcgct
atgggtataactggaacggatgtttgtaaaaacgcatcggatattatacttacagatgat
aattttaaaactataattacagcagttgaagaaggaagaaacatatttaacaacataaaa
aaatctataatatttctattaacatgtaatcttggagaaatattaacaatttttatatca
attttatttaaatttccagtaccattaagtcctatacatttattatggataaatctaata
acagattctctacctgctcttagccttggcgttgatacttacgacaaaaatataatgaat
aataaacccagaaaaggtaacaaaaatttgatttcaaaatcaaatataattaaactaatc
ttaaatggattcataattggaattgtaagtataacatccttcttaactagatataaaaaa
gtaaatctcatatatgcccaaagtatggcattcatagttttatcattttctcaattattt
ctatctttaagcatacgctctgaaaaagaatatttatttaagataggattattttcaaat
atgaaactcatttactcaatattacttggggtaattatacagataattttaataaaaatc
ccatcatttaattcattcttcaacactcaaaatctaagcacaaatgattggattatatca
ataatcttatctttaataccatttataataagcgaattattaaaagcttttacccataaa
aaataa

DBGET integrated database retrieval system