KEGG   Alistipes shahii: AL1_00490Help
Entry
AL1_00490         CDS       T02578                                 

Definition
(GenBank) Glycoside hydrolase 97.
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
ash  Alistipes shahii
Pathway
ash00500  Starch and sucrose metabolism
ash01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ash00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AL1_00490
Enzymes [BR:ash01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AL1_00490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C LPAM_1
Motif
Other DBs
NCBI-ProteinID: CBK62784
UniProt: D4IIM6
LinkDB All DBs
Position
complement(65760..67955)
Genome map
AA seq 731 aa AA seqDB search
MKKIFLYISALLAGAACTAQETLLSPDGRLRLEFSLADGGRPTYTLDYKERPVILPSGMG
LELRGEAPKLEFGAEIRKGEPGRPVSLYDGFTLGQVARSESDQTWRPVWGEQAEIRDRYN
EMAVTLRQAATGRDMTIRFRLYDDGLGFRYEFPEQESLTYFVIGEEKTQFAMAGDHTAFW
IPGDYDTQEYDYTESKLSQIRELMPGAITPNSSQTPFSPTGVQTALQMKSDDGLYINIHE
AALVDYACMHLDLDDRNFIFTSHLTPDAQGWKGYMQAPCHTPWRTVTVSDDARDILASKL
ILNLNEPCAYDDTSWIKPVKYMGVWWEMITGKSDWAYTRDVPSVQLGVTDYARCRPSGRH
GAENENVKRYIDFAAAHGFDQLLVEGWNVGWEDWFGHTKDYVFDFVTPYPDFDIAALNEY
AHGKGIRLMMHHETSASVRNYERHMEAAYRLMDKYGYNSVKSGYVGDILPRGEHHYGQWM
NNHYLYAVRRAADHKIMVNAHEAVRPTGLCRTYPNLIGNESARGTEYQAFGGSKPHHVTI
LPFTRLQGGPMDYTPGIFVMDVAEVNPGNHSHVNATLANQLALYVTMYSPLQMAADLPEH
YEKYMDAFRFIEDVALDWEESRYLLAEPGDYIVVARKAKDTGEWFVGGVTDENRRTVTLP
FDYLDPGKEYVATLYADAPDADYQTNPQAYVIRTGKVRQRTELDVEMARGGGFAISIREA
TDADRKLCKLK
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatatttttatatatctccgcgctgctggccggtgcagcctgcacggcacag
gagacgctcctctcgcccgacggccgcctccgcctggagttcagcctggcggatggaggc
cgccccacctatacgctcgattacaaggagcgccccgtgatcctgcccagcggcatgggg
ctcgaactgcgcggcgaagccccaaagttggaattcggggctgaaatccgcaagggcgaa
ccagggcgcccggtatcgctctacgacgggttcaccctcgggcaggtggcccgcagcgag
tccgaccagacatggcgtcccgtatggggcgagcaggccgagatccgcgaccgctataac
gaaatggccgtcacgctgcggcaggccgcgacaggccgcgacatgacgatccgcttccgg
ctctacgacgacgggctcggattccgctacgaattccccgaacaggagtcgctgacctat
ttcgtcatcggcgaggagaaaacacagttcgccatggcgggcgaccacacggcgttctgg
atcccgggcgactacgacacgcaggagtacgactacacggagtcgaaactctctcagata
cgggagctgatgcccggcgccatcacgcccaactcgtcgcagacgcccttctcgcccacg
ggcgtacagacggccctgcagatgaagagcgacgacgggctctacatcaacatccacgaa
gcggcgctggtcgactatgcgtgcatgcacctcgacctggacgaccggaatttcatcttc
acctcgcaccttacgcccgacgcacaggggtggaaaggctacatgcaggcgccctgccat
accccgtggcgcacggtgacggtctcggacgacgcccgcgacatcctcgcctcgaagctg
atcctgaacctcaacgagccgtgcgcctatgacgacacctcgtggatcaagcccgtgaaa
tacatgggcgtatggtgggaaatgatcaccggcaagagcgactgggcctatacgcgcgac
gtgccgtcggtacagctcggcgtgacggattacgcccgatgcaggcccagcggccgccac
ggcgccgagaacgagaacgtgaagcggtacatcgacttcgcggcggcacacgggttcgac
cagctgctcgtcgaaggctggaacgtcggctgggaggactggttcgggcacacgaaggat
tacgtcttcgatttcgtgaccccctaccccgatttcgacatcgccgcactgaacgaatat
gcgcacgggaaaggcatccggctgatgatgcaccatgaaacgtcggcttcggtgcgcaac
tacgaacgccacatggaagcggcctaccgcctgatggacaaatacgggtacaactcggtc
aagagcgggtacgtgggcgacatcctgccccgcggcgagcaccattacgggcagtggatg
aacaaccactacctctatgccgtccgccgggccgccgaccacaagatcatggtcaacgcc
cacgaggcggtgcgcccgacgggcctctgccgcacctaccccaacctgatcggcaacgag
tcggcacgcggcacggagtaccaggcgttcggcggctcgaagccccaccatgtgacgatc
ctgcccttcacgcgcctgcagggcggcccgatggactacacgcccggcatcttcgtgatg
gacgtcgcggaggtcaaccccggcaaccactcgcacgtcaacgcgacgctcgccaaccag
ctggcgttgtacgtgacgatgtactcgccgctgcagatggcggcagacctgcccgagcac
tatgagaaatacatggatgcgttccgtttcatcgaggacgtcgcactggactgggaagag
agccgctacctgctggccgaaccgggcgactacatcgtcgtggcgcgcaaggccaaagac
acgggcgagtggttcgtgggcggcgtgacggacgagaaccgacgtacggtgacgctcccg
ttcgactacctcgatcccggtaaggagtacgtggcgacgctctacgccgatgcccccgat
gccgattaccagaccaatccgcaggcatatgtcatccgcaccgggaaggtcagacaacgc
acggaactcgacgtggagatggcgcgcggcggaggctttgcaatctccatacgcgaggca
accgacgcagaccgcaaactctgcaagctgaaataa

DBGET integrated database retrieval system