KEGG   Alistipes shahii: AL1_10740Help
Entry
AL1_10740         CDS       T02578                                 

Definition
(GenBank) Alpha-amylase/alpha-mannosidase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
ash  Alistipes shahii
Pathway
ash00500  Starch and sucrose metabolism
ash01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ash00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AL1_10740
Enzymes [BR:ash01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AL1_10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: CBK63586
UniProt: D4IKX4
LinkDB All DBs
Position
1209172..1210389
Genome map
AA seq 405 aa AA seqDB search
MKTVCLYFQVHQPWRLKKYRFFNMGKDHNYLDDLINRSIMQKVARQCYLPMNALLLKLIR
ENKGKFRCSFSITGIAIEQFRAFAPEVLDSFKELAATGCVEFLAETYSHSLASLASKEDF
TEQVKLHTNLIKKEFGVKPTAFRNTELIYSDEIGAMVAGMGFRTMLAEGAKHVLGWKSPN
YVYANAIDQKLRLLLRNYKLSDDIAFRFSNKSWDQWPLTADKYVQWLASDETPGEVINLF
MDYETFGEHQNADTGIFEFMRALPKAILARKNGLEFATVTEAAKKHQPVAVLHCPHVMSW
ADEERDVTAWLGNELQNEAFSKLYAQKEKVAALKNPDFDYVWSFMQTSDHFYYMATKWLS
DGDVHSYFNPYDSAYDAFINYMNVLSDFIIELDKAVAAKAAKKRA
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgtctgtctctattttcaggtgcatcagccctggcgtctgaagaaataccgc
ttcttcaacatgggcaaggaccacaactacctggacgaccttataaaccgttcgatcatg
cagaaggtcgcccgccagtgctacctgccgatgaacgccctgctgctcaagctcatcagg
gagaacaagggcaagttccgctgttcgttctcgatcacgggcatcgccatcgaacagttc
cgcgccttcgcccccgaagtgctcgactcgttcaaggagcttgccgcgacgggctgcgtg
gagttcctcgccgagacctactcccactcgctggcatcgctggcatcgaaggaggatttc
acggagcaggtcaaactgcacacgaaccttatcaaaaaggagttcggggtgaaacccacc
gctttccgcaacacggagctgatctattcggacgagatcggcgcgatggtcgccggcatg
ggcttccgcacgatgttggccgaaggagccaagcacgtgctggggtggaaatcgcccaac
tacgtctacgccaacgccatcgaccagaaactgcgcctgctgctgcgcaactacaaactc
tcggacgacatcgctttccgcttctcgaacaagagctgggaccagtggcccctgacagcc
gacaagtacgtgcagtggctcgcctcggacgagacgccgggcgaggtcatcaacctgttc
atggattacgagaccttcggcgagcatcagaacgccgacacgggcatcttcgaattcatg
cgcgcgctgcccaaggcgatcctcgccaggaagaacggcctggagttcgccacggtgacc
gaggccgcgaagaagcaccagcccgtcgccgtgctccactgtccgcacgtgatgtcgtgg
gccgacgaggagcgcgacgtgacggcctggctgggcaacgaattgcagaacgaggctttc
tcgaagctctatgcccagaaggagaaggtcgcggcgctgaaaaatcccgatttcgattat
gtctggagtttcatgcagacctccgaccatttctactacatggccaccaagtggctgtcg
gacggcgacgtgcactcctacttcaacccctacgattcggcctacgacgccttcatcaac
tacatgaacgtcctctcggacttcatcatcgagctggacaaggcggtagctgccaaggcg
gcgaaaaaacgggcctga

DBGET integrated database retrieval system