KEGG   Alistipes shahii: AL1_19890Help
Entry
AL1_19890         CDS       T02578                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ash  Alistipes shahii
Pathway
ash00564  Glycerophospholipid metabolism
ash01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ash00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AL1_19890
Enzymes [BR:ash01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AL1_19890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Lycopene_cycl Pyr_redox_2 FAD_binding_3 GIDA NAD_binding_8 HI0933_like Pyr_redox Pyr_redox_3 ptaRNA1_toxin Thi4
Motif
Other DBs
NCBI-ProteinID: CBK64321
UniProt: D4IN09
LinkDB All DBs
Position
2271252..2272820
Genome map
AA seq 522 aa AA seqDB search
MERASQIKKLSDKGKIWDMVVVGGGATGLGVAVDAATRGMSVACLEKTDFAKCTSSRSTK
LVHGGVRYLQKGDVMLVLEALRERGRMKANAPHLVKDQAFVISNYRYWDNFLYFCGLTFY
DLLSFGFGYGRSKYISAKKVMKYIPTSVEKGLKGGVVYHDGQFDDSRMAINLAQTCVENG
GTVVNEATVTGILHNEAGKVAGVKFVDNTTGEEYSIKARSVVNAAGCFVDDIMHMDSPEH
RKMVTPSQGVHLVLDMKFLQSDYAIMVPKTSDGRVLFAVPWHDKVVVGTTDIVRPTPEEE
PRPLKEEIDFILGTAGLYMNPAPTYKDILSVFAGQRPLAAPKKEGKNTKEISRSHKVITS
DNGLVTITGGKWTSYRLMAEDTVDKAIEVAGLPRRKCVTKKFHIHGYRKNPNLADHMYVY
GSDEPKILNLIKENPALGEKLSPKFGYTLAEVVWAVREEMALTVEDVLARRVRLLFVDAR
EAMAAAPKVAETMARELGRDQAWIDAQVESFTKMAKNYIFEA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atggaaagagcatcacaaatcaaaaagttgtccgacaagggcaaaatctgggacatggta
gtcgtaggcggcggtgcgaccggactcggcgtcgcggtggatgcagccacgcgcggcatg
agcgtagcctgcctggagaagaccgactttgcgaaatgtacgtcgagccgttcgaccaaa
ctcgtgcacggcggcgtgcgctacctgcaaaagggcgacgtgatgctggtgcttgaagcg
ttgcgcgagcgcggccgcatgaaggccaacgccccgcatctggtgaaggaccaggcgttc
gtcatttcgaactaccgctactgggacaatttcctttacttctgcggcctgaccttctac
gatctgctctcgttcggcttcggctacggacgttcgaagtacatctccgccaagaaagtg
atgaaatacatccccacctcggtcgaaaaggggctgaagggcggcgtggtctaccacgac
ggacagttcgacgactcgcgcatggccatcaacctcgcccagacctgcgtcgagaacggc
ggcacggtcgtcaacgaggccaccgtgacgggcatcctgcacaatgaggcgggcaaggtc
gccggcgtgaagttcgtcgacaacaccaccggcgaggagtattcgatcaaggcgcgcagc
gtcgtgaacgccgccggctgcttcgtcgacgacatcatgcacatggacagccccgaacac
cgcaagatggtcaccccgagccagggcgtgcacctcgtgctggacatgaaattcctgcag
agcgactatgcgatcatggttcccaagacctcggacggccgcgtgctgttcgccgtgccc
tggcacgacaaggtcgtggtcggaacgaccgacatcgtgcgccccaccccggaggaggag
ccgcgtccgctgaaggaggagatcgacttcatcctcggcaccgcgggactctacatgaac
ccggcgcccacctacaaggacatcctctcggtattcgcgggtcagcgtccgctggcggcg
cccaagaaggagggcaagaacacgaaggagatttcgcgcagccacaaggtcatcacctcg
gacaacggtctggtgacgatcaccggcggcaagtggacctcctaccgcctgatggccgag
gacacggtggacaaggccatcgaagtagcgggacttccccggcgcaagtgcgtgaccaag
aaattccacatccacggctaccgcaagaatcccaacctcgccgaccatatgtacgtttac
ggttcggacgagccgaagatcctgaatctgatcaaggaaaacccggcgctgggcgaaaag
ctctctccgaagttcggctacacgcttgccgaggtggtttgggccgtgcgcgaggagatg
gccctcacggtcgaggacgtgctggcgcgccgcgtgcggctgctgttcgtcgacgcccgc
gaggcgatggccgccgccccgaaggtcgccgaaacgatggcccgcgaactgggccgcgac
caggcatggatcgatgcgcaggtcgaaagtttcacgaagatggcgaaaaattatatcttt
gaagcttaa

DBGET integrated database retrieval system