KEGG   Actinobacillus suis H91-0380: ASU2_00890Help
Entry
ASU2_00890        CDS       T02262                                 

Definition
(GenBank) anthranilate synthase component II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asi01100  Metabolic pathways
asi01110  Biosynthesis of secondary metabolites
asi01130  Biosynthesis of antibiotics
asi01230  Biosynthesis of amino acids
asi02024  Quorum sensing
Module
asi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:asi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ASU2_00890
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    ASU2_00890
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ASU2_00890
Enzymes [BR:asi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     ASU2_00890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26 Glyco_trans_4_2 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AFU18320
UniProt: K0G9I6
LinkDB All DBs
Position
complement(176513..177100)
Genome map
AA seq 195 aa AA seqDB search
MAHILFVDNFDSFTYNLVDQFRELGHQVTIFRNDYPLEDFLNKAQTTENCIVALSPGPGT
PAEAGNMLAIIKQLKGVVPMIGICLGHQAIIEALGGRIVHTGTVLHGKVSKIEHDNQAMF
HGINNPMPVARYHSLMGDNLPEELEINARFDNIVMAIRHKQLPICGFQFHPESILTVEGT
KLLKQSVEWLLSTQH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcacatattctttttgttgataattttgattcgtttacctacaaccttgtcgatcaa
tttcgtgaattaggtcatcaagtaactatttttcgtaacgattacccattagaagacttt
ctaaacaaagcacaaactaccgaaaattgtattgtagcgctttcgcccggccccggcaca
ccggcagaagccggcaatatgttagcaattattaaacagctcaaaggcgttgtaccgatg
attggtatttgtttgggtcatcaagcgattatcgaagcgttaggcggacgtatcgtgcat
accggtactgttttacacggcaaagtgtctaaaattgaacacgataaccaagcaatgttc
cacggtattaataacccgatgccggttgcccgttaccattcattaatgggtgataaccta
ccggaggagttagaaatcaatgctcgcttcgataatatcgtgatggcgattcgccacaaa
caattaccgatttgcggctttcaatttcacccagaatcaatcctaaccgtagaaggcact
aaattattaaaacaatcggtcgaatggctgctttccacacaacattaa

DBGET integrated database retrieval system