KEGG   Actinobacillus suis H91-0380: ASU2_01905Help
Entry
ASU2_01905        CDS       T02262                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase/endopeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:asi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ASU2_01905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:asi01002]
    ASU2_01905
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:asi01011]
    ASU2_01905
Enzymes [BR:asi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ASU2_01905
   3.4.21  Serine endopeptidases
    3.4.21.-  
     ASU2_01905
Peptidases [BR:asi01002]
 Serine Peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   ASU2_01905
Peptidoglycan biosynthesis and degradation proteins [BR:asi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   ASU2_01905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AFU18523
UniProt: K0G2Z9
LinkDB All DBs
Position
complement(423806..425248)
Genome map
AA seq 480 aa AA seqDB search
MLLKSVRSYIQNLLLTSIFIPSISFAEINTSELLTNLPAGASASFIAKNLETNQIITQYQ
SDVFMLPASTQKVFTALAAKLVLPNDFRFQTALLTNGKVENGIIKGDLIAKFTGDPDLTS
GQLYQLIGQLKKQGIEKIEGNLILDTSVFASHDKAAGWIWNDLTMCFNAPPAAVNVDNNC
FYVNLDTNQKVGDFAKVNVPAAYPVQVFSSAYIVDKAEAPYCQLDVVVNDNNRYQIKGCM
ARQAEPFGLSFSVQDPATYGANLIKANLKRLGIAFEGKIQEPLNAQKGTLLAEHWSAPLP
DLLKKMMKKSDNQIADSLFRTIANQQHNRPASFPLASHVLRTLLKSKAGVTFGNSIVADG
SGLSRHNQINAETMLQALEYIAKNEAQLQLFETFPIAGVDGTISGRGSISVEPLAKNLIA
KTGSLKGVYNLAGFMKNARGERIAFVQFVNGYSTGELESKTKRAPLVNFENKFYMALFNE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgttgttaaaatccgttcgctcatacattcaaaatcttttactgacgagtatctttatt
ccgagtatttcttttgccgaaataaatacctcggagcttctcaccaatttaccggcaggt
gcctccgccagttttattgcgaaaaacctcgaaaccaatcaaattattacacaatatcaa
agtgatgtttttatgttgccggcaagtacacaaaaagtatttaccgcacttgccgccaaa
ttggttttaccgaatgattttcgctttcaaacggctttattaacgaatggaaaagtggaa
aacggaataataaaaggtgatttaatcgccaaattcacaggtgatccggatctcactagc
ggtcagctttatcagcttatcgggcaattaaaaaaacaaggtattgaaaaaatagaaggc
aatttaattttagatacctccgtttttgccagtcatgataaagcggcgggttggatttgg
aatgatttaactatgtgctttaacgctccgcctgccgccgtcaatgtggataacaactgc
ttttatgtcaatttagacaccaatcaaaaagtcggtgattttgcaaaagttaatgttccc
gccgcctatccggtacaagtatttagctcggcttatatcgtcgataaagcggaagctcct
tattgccagttggatgtcgtagttaatgacaacaaccgctatcaaatcaaaggctgtatg
gctcgccaagcggaaccgttcggattgagtttttccgtacaagatcccgctacttacggt
gcaaatttgattaaagcgaatttaaagcgcctaggcattgcttttgaagggaaaattcaa
gaaccgcttaatgcgcaaaaaggtactttgttggcggaacattggtctgctccgttaccg
gatcttttaaagaaaatgatgaaaaaatccgataaccaaattgcggatagtctattcaga
accattgccaatcagcagcataatcgtccggcgtcttttccgttagctagtcacgtatta
cgcactttattaaaatctaaagcgggcgttacctttggaaatagtattgtcgcagacggt
tcaggtctttctcgtcataaccaaatcaatgcggaaacgatgttgcaagcccttgaatat
attgcaaaaaatgaagcgcaattacagctgtttgaaaccttcccgattgcgggtgtggat
ggtacgatttccggtaggggctctatctccgtcgaaccgctggcgaaaaatctgattgcc
aaaaccggttcactgaaaggggtatataatctggcgggctttatgaaaaatgcgcgaggt
gaacgtatcgcctttgtacaatttgtaaacggctattcaaccggcgagctggaaagtaaa
accaaacgtgcgccgttagtgaattttgaaaataaattttatatggcgctctttaacgaa
taa

DBGET integrated database retrieval system