KEGG   Actinobacillus suis H91-0380: ASU2_03945Help
Entry
ASU2_03945        CDS       T02262                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00240  Pyrimidine metabolism
asi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    ASU2_03945
Enzymes [BR:asi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ASU2_03945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 DUF2075 AAA_14 AAA_30
Motif
Other DBs
NCBI-ProteinID: AFU18927
UniProt: K0FWX6
LinkDB All DBs
Position
847692..848273
Genome map
AA seq 193 aa AA seqDB search
MAKLYFYYSSMNAGKSTTLLQSSYNYQERGMNTLVYTAAIDDRYGVGKVSSRIGISQEAQ
LFQSESNLFDEIQRTNQEKTLHCILIDEAQFLTKTQVYQLTDVVDKLKIPVLCYGLRTDF
QGELFEGSQYLLAWADELQELKTICDCGKKAHFVIRMNENGEAVADGDQIQIGGNDKYLS
VCRYHYKQKLNKL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaactctatttttattactcttcaatgaatgcaggaaagtcaaccaccctgctt
caatcctcttataactaccaagaacgaggcatgaatactttggtttataccgctgcgatt
gatgatcgttatggtgttggcaaagtaagctctcgtattggcatttcacaagaagcgcaa
ttatttcaatcggaatcaaatttattcgatgaaattcaacgtactaaccaagaaaaaacg
ttacactgtatcttaattgatgaagctcaatttcttacgaaaacgcaggtatatcaatta
acggatgtagttgataaactgaaaattccagtgctatgctatggtctacgtactgatttc
caaggtgagctctttgagggaagccagtatttattagcctgggcagatgaattacaagaa
cttaaaacgatctgtgattgcggaaaaaaagcccactttgttattcgtatgaatgagaac
ggcgaagccgtcgctgatggagatcaaattcaaatcggtggtaacgataaatacctctct
gtttgtcgctatcactacaaacaaaagctaaataaactatag

DBGET integrated database retrieval system