KEGG   Actinobacillus suis H91-0380: ASU2_09185Help
Entry
ASU2_09185        CDS       T02262                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00550  Peptidoglycan biosynthesis
asi01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:asi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ASU2_09185
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    ASU2_09185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:asi01011]
    ASU2_09185
Enzymes [BR:asi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     ASU2_09185
Peptidoglycan biosynthesis and degradation proteins [BR:asi01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   ASU2_09185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer SURF1 Sec15
Motif
Other DBs
NCBI-ProteinID: AFU19967
UniProt: K0FZH5
LinkDB All DBs
Position
complement(2024691..2026661)
Genome map
AA seq 656 aa AA seqDB search
MFGKLGKLTNPKPREKVRDGQAESNLFARRALVAFIGVLALTGVLLTNLYHLQIVNYDDY
QTRSNGNRIKLLPVPPTRGLIYDRNGKVLAENITYFGLYIIPEKTENLEETLVELRDVVG
LTDEDVEAFRKEKKRTSRYTPILLKGNLNEEQMARFAVNQYRFPSLDVQAYYKRNYPYGE
TLTHIIGYVAKINEKDKKKLEEEGKFGNYAGSHDIGKLGIEKYYEDQLHGQTGFEEVEIN
NRGKVIRKLRDQPGVAGSSIRLTIDVELQQYIQNLLGNQKGSVVVLDPRDSSVLAMVTNP
SYDNNLFVGGVSGADYKRLLEDPARPLYSRATQGTYPPASTVKPFYAVMGLAEGKITPYG
AIYDPGFWVLPGTTQRYRDWKKGGHGSTNVNKAIAESSDTFFYQLAYDTGIEKMSEWMRK
FGFGQKTGIDIFEESAGVYPNREWKQRRHKKPWVQGDTIPVGIGQGYWIATPLQVAKAQA
ILINNGRVNTPHLMMEVISSDKVEPYKDPLKYEDIKGVPERFWQVAKFGMYNVVNAANGT
GRKAGGSFYRAAGKSGTAQVFNLNGGKYNKNALKKELHDHAWFISYAPYEDPKVSVAIIL
ENAGGGGSNAAPVARQVMDFALSKTLKEPIGTSEQPSQNIEQIQPLISEQGNTHNE
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtaaactcggaaaattaaccaatccaaagcctcgtgagaaagtgcgagatggg
caagcggagagcaatctgtttgctcgtcgtgcattagtcgcatttattggggtattggcg
cttacgggcgtgttattaaccaatttgtatcatttacagattgtgaattatgacgattac
caaactcgttccaacggcaaccgtatcaaattgctcccggttccgcctacccgcggtttg
atttatgaccgcaacggtaaagtattagccgaaaatattacctatttcgggctttatatc
attcctgagaaaacggaaaacctggaagaaaccttagttgaattgcgtgatgtggttggg
ctaaccgatgaagatgtggaagcattccgtaaagagaaaaaacgtacctctcgttatacg
ccgattttattaaagggcaatttaaacgaagagcaaatggcacgttttgcggtaaaccaa
tatcgtttcccaagtttagacgtacaggcgtactacaaacgtaattatccttatggagaa
acgctaactcatattattggatatgtggcgaaaatcaacgaaaaagataagaaaaagctc
gaggaagagggtaaattcggtaattatgccggatctcacgatattggaaaattgggcatc
gaaaaatattacgaagaccaattacacggacaaaccggttttgaagaggtagaaatcaat
aaccgaggcaaagtgattcgcaaattgcgtgatcagccgggtgtggcgggcagtagtatt
cgcttaaccattgatgttgagttacaacaatatattcagaatttgttgggcaaccaaaaa
ggctcggtcgtagtgcttgaccctcgtgacagcagtgtattggcgatggtaaccaacccg
agctatgacaataacttatttgtcggcggcgtctcgggggcggattataaacgattattg
gaagatcctgcccgtccgttatatagccgtgccacgcaagggacttatcctccggcttct
acggtaaaaccgttttatgcggtgatgggattggcggaaggcaaaattacgccttatggg
gcgatttacgatccgggattttgggtattacccggtaccacacaacgttatcgagattgg
aagaaaggcggtcacggttcaaccaatgtgaataaagcgattgccgagtcttccgatacg
ttcttctatcaacttgcgtatgataccggtattgaaaaaatgtcggaatggatgcgtaaa
ttcggttttgggcagaaaacggggattgatatttttgaagaatccgccggtgtgtatccg
aatcgtgagtggaaacaacgccgtcataaaaagccttgggtacaaggtgataccattccg
gtagggatcggtcaaggttactggattgcaacaccgttacaagtggcaaaagcacaagcg
atattaattaataacggtcgtgttaatacgccgcatttaatgatggaagtgatcagcagc
gataaagtcgaaccgtataaagacccgcttaaatatgaagatattaaaggcgtgccggag
cgtttttggcaagtggcaaaattcggaatgtacaatgtagtgaatgcggcaaacggtacc
ggacgcaaagccggcggttcgttttatcgtgccgcaggtaaaagcggtacggcgcaggta
tttaacttaaacggtggtaaatacaataagaatgcgttgaaaaaagaactacacgaccat
gcgtggtttattagttatgcaccatatgaagatccgaaagtttcggtggcgattatttta
gaaaatgcgggcggtggcggttcaaatgccgcaccggtggcgcgccaagtgatggatttt
gcattaagcaaaacgctaaaagaaccgatcggaacgtcggaacaaccttcgcaaaatatt
gagcaaattcaaccgcttataagcgagcaaggaaatactcacaatgaatag

DBGET integrated database retrieval system