KEGG   Acinetobacter schindleri: AsACE_CH00640Help
Entry
AsACE_CH00640     CDS       T04787                                 

Definition
(GenBank) chromosome segregation protein SMC
  KO
K03529  chromosome segregation protein
Organism
asj  Acinetobacter schindleri
Brite
KEGG Orthology (KO) [BR:asj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:asj03036]
    AsACE_CH00640
Chromosome and associated proteins [BR:asj03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Condensin-like complex
    AsACE_CH00640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SMC_N AAA_15 AAA_21 AAA_29 BLOC1_2 Nup54 AAA_13 ABC_tran
Motif
Other DBs
NCBI-ProteinID: APX62077
UniProt: A0A1P8PHT3
LinkDB All DBs
Position
678661..682113
Genome map
AA seq 1150 aa AA seqDB search
MRLSSLKLSGFKSFADSTTLHFKDNRTAVVGPNGCGKSNVIDAIRWVMGESSARQLRGGS
MQDVIFTGTAKRKPVGIASVELRFENTYGKLGGAYNAYNELAVRRQVNRDGKSEYFLNGT
KCRRRDITDIFLGTGLGPRSYAIIEQGMINRLVDAKPEEMRVYIEEAAGVSRYQARRRET
MQHLEHTTQNLSRLEDIASELKSQLKTLKRQSETAIQYKELEGQIRTLKIEILSFQCEQS
QRLQEEYTIEMNTLGDSFKLVRSELTTVEHDLGATSELFQRLIQQSTPLQNEWQQAEKKL
AELEINLKQKQSLLEQNSTSLVQLEQQKAQTKERLQLIELQLDTLQEQLEDQTTQLQQQE
GLSQDQQQGLQELKSQQASVATQFAQIKTQVEQQQQRKMQMLAQSEQLAKNIVRIEQQKE
TLQQQSAQIQNQAQQDELEQYHREKADTEQQLIRLESHYVELSQQLEQVKQAHSEQQQQQ
MQLKSELQVLNAEKKNLSQLLAKANPAAKADTVQLMHVLKLNEQGKAHASLIEKFLEKWL
SAQVLSDSDHFLENTARQLKAQQSPAKIQLANVQSLADWIEKPQYSLWQQVAVVETLQQA
LQLQNQLQSGQSILSLDAYHVGPDWVIGLEFDEASQAGQGALSHRIRLDEIELQLAKLEE
QSRQAEQHLAESKEQLTALQIQLQQITSQQQQAQKQLQQLDLNIAKVQSAAQAFAVQKQQ
LQNQLQQLDEQLEEDAMQKDDLEIDLHALNLKLEQALPNYKTLQFQLDELTTQLEDCQQQ
THNAQQELEITRRQSVQSKQQVELLEKDRVFLKEQYQQILQQIEQAKKFIDPVQLELPHL
ESQFNEQVELTGKLQKTWSEWQVELNQVQNKQQQLTEQRHQFQQQDEMLRNRLEQKRLAW
QAAKSNLQHYSEQLKELNGEVITGLNIEVKVHQAKLEKAQSQFDKLGAVNLAASEEYEEV
SKRYNELSHQIQDLENTVEQLQAAMKSIDQETRKLFMHTFDQVNAELQNLFPKVFNGGEA
SLSLEDGWQSGVKLMARPPGKRNSSLALLSGGEKALTALALVFAIFRLNPAPFCVLDEVD
APLDDANVGRFCNLVKELSEQVQFIYITHNKLAMMMATDLLGVTMPEPGTSKLVTVNLEQ
AKEYGLAAEA
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttaagcagtttaaaactttcaggcttcaaatcttttgccgatagtacaacttta
cactttaaagataaccggactgccgttgtggggcccaatggttgtggcaagtctaacgtc
atcgatgcaattcgctgggtaatgggggagtcgagtgcccgtcagttacggggcggcagc
atgcaggatgtgatttttaccggaacggccaaacgtaaaccggtgggaattgccagtgta
gaactgcgctttgaaaatacctatggcaagctcggcggtgcctataatgcctataacgag
ctggccgtacgccgtcaggtcaaccgggatggcaagtctgaatatttcctgaatggcacc
aaatgtcgtcgtcgtgacatcactgatattttcctgggtactggtctgggaccacgttcc
tacgccattatcgagcagggcatgattaaccgtctggtcgatgccaagcctgaagaaatg
cgggtttatatcgaagaggcagcgggcgtatcgcgctatcaggcccgccgtcgcgaaacc
atgcagcatctggaacataccacccagaatctgtctcgcttagaagatattgcttccgaa
ctcaagtcccaactcaaaaccttaaaacgccagtccgaaactgcaattcaatataaagaa
ctcgaagggcagatccgtaccctgaaaattgaaatactgtcattccagtgcgagcaaagc
cagcgcttgcaggaagaatataccattgagatgaacacgctaggcgacagcttcaagtta
gtacgttctgaactgaccacggttgagcacgatctgggagcaaccagtgagctgtttcag
cgtctgattcagcagtccaccccattgcaaaatgaatggcaacaggccgagaaaaagctg
gctgaactagaaataaacctgaagcagaaacagtctctgctggagcaaaactcaaccagc
ctggtgcaactagaacaacagaaagctcaaaccaaagaacgtttacagttgattgaattg
caactggataccctacaagagcaactagaagatcaaaccacacagttacaacaacaggaa
ggtttaagtcaggatcagcaacaaggtttgcaggaactgaaatctcaacaggcttcagtc
gcgacccagtttgctcagattaaaactcaagtcgaacagcaacagcagcgcaagatgcag
atgctggcacaaagcgagcaattagctaaaaatattgttcgtatcgagcagcaaaaagaa
accttgcagcaacaatcagctcagattcagaatcaagcacagcaagatgagctggaacag
tatcatcgggagaaagctgatactgaacaacagctgattcgcctagaaagccattatgtt
gagctgagccagcagctggaacaggtcaaacaggcacatagcgaacaacagcaacaacag
atgcagttgaaatctgaattgcaagtattgaatgcagaaaagaaaaacctttcccaactt
ctggcgaaagctaatccggcagctaaagcggataccgtgcaactgatgcatgtgctaaaa
ctgaatgagcagggcaaagcccatgccagcctgatcgaaaaattcctggaaaaatggctg
tctgctcaggtactttcggattcagatcattttctggaaaatacagcacgtcaactgaaa
gcacagcaatcgcctgctaaaatccagctagcaaatgtccaatctctggcggactggatt
gaaaaaccacagtattctttatggcagcaggtcgccgtagtggaaacccttcagcaagcg
ctacaactacaaaaccaattgcagtcgggtcaatccatccttagtttagatgcttatcat
gtcggtccagactgggtgattggactagagtttgatgaagctagccaggcaggtcaaggc
gcactgagccaccggattcgtctggatgaaattgaactacaactagctaagctggaagag
caatcccgccaagctgaacagcatttggctgaatcaaaagaacagctgacagcgctgcaa
attcagctacagcaaatcaccagtcaacagcaacaggcacagaagcagctgcaacagctg
gacttaaatattgccaaagtgcaaagcgccgctcaggcttttgctgtgcagaaacagcag
ttgcagaaccagctccagcagctagatgaacagcttgaagaagatgcaatgcaaaaagat
gatctggaaattgatctgcatgcattaaacctaaaactggaacaggctttaccgaattat
aagaccttgcaattccagctggatgaactgactacgcaactggaagattgccagcagcaa
acccacaatgctcagcaggaactggaaattacccgtcgtcaatcggttcagtccaaacag
caagtcgaattgctagaaaaagaccgggtattcctgaaagagcagtatcaacaaattctc
caacagattgaacaggccaagaaatttattgatccggtacagttagaactgccgcatctg
gaaagccagtttaacgagcaggtggaattgacagggaaactgcaaaaaacctggtcagaa
tggcaggtcgagctgaatcaggtacaaaataaacaacagcagctcactgaacagcgccat
cagttccagcagcaggatgaaatgctgcggaatagactggaacagaaacgcttggcttgg
caagcagctaaatctaatctgcaacactattctgagcagctaaaagaattgaatggtgaa
gtcattactggtctgaatatcgaagtcaaagtacatcaggccaagctggaaaaagcccaa
tcgcagttcgacaagctcggagcggtgaatcttgcagcatctgaagaatatgaagaggtt
tcaaaacgctataatgagttgagccatcagattcaggatctggaaaataccgtcgagcag
ctgcaggcggccatgaagagcatcgatcaggaaacgcgcaagctgtttatgcatactttt
gatcaggtcaatgctgaattgcaaaacctgttcccgaaagtatttaatggcggtgaagcg
agcttaagtcttgaagacggatggcaatcaggtgtaaaactgatggcacgaccaccaggt
aagcgtaacagttcattagctttattgtctggtggtgaaaaggcattaactgcattggct
ctggtgtttgcgatttttcgtctcaatccagcgccattctgtgtgctcgatgaagtcgat
gcaccattggatgatgcaaatgtggggcgtttttgtaatttagtcaaagagctttcagaa
caagtgcaatttatttacatcacacataataagcttgcaatgatgatggcaacagacctc
ttgggtgtgaccatgcctgaaccgggcacatcaaaactggttacagtgaatttggaacag
gcaaaagaatacggcttagctgcggaggcataa

DBGET integrated database retrieval system