KEGG   Acinetobacter schindleri: AsACE_CH01049
Entry
AsACE_CH01049     CDS       T04787                                 

Gene name
rlmL
Definition
(GenBank) 23S rRNA m(2)G2445 methyltransferase/23S rRNA m(7)G2069 methyltransferase
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
asj  Acinetobacter schindleri
Brite
KEGG Orthology (KO) [BR:asj00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:asj03009]
    AsACE_CH01049 (rlmL)
Enzymes [BR:asj01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     AsACE_CH01049 (rlmL)
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     AsACE_CH01049 (rlmL)
Ribosome biogenesis [BR:asj03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    AsACE_CH01049 (rlmL)
SSDB
Motif
Pfam: UPF0020 Methyltrans_SAM THUMP Cons_hypoth95 MTS N6_Mtase AbfB
Other DBs
NCBI-ProteinID: APX62465
UniProt: A0A1P8PIZ2
LinkDB
Position
complement(1122183..1124387)
AA seq 734 aa
MNTSSRLSNYWVTCADGLETLLEEEIKGLGVQDIERFPGRLTFKGTLENAYRICMWSRLA
SRVLMPIHTHEIEFSHDARDVAEELYEGAISFDWSLIFAPQSTFAIRLHVERDIKVNTQF
ATLRAKDGVVDSFMEAVGKRPSIDTKQPEITMYILAGKKAHAYCLDLSGDSLHKRGYRRF
MTEAPIKENLAAAILQKGGLKDINPDIVVDPMCGSGTFIIESLMILTDRAPGLVRRFGFN
GWNGHDHELWMGIKAEAAERHKAALENPLPKFYAFDADWEAVKATKQNIIAAGFESALDQ
IMIEERTLNDWPDFQAEGKKVFFVTNPPYGERLGDKASNRALYLGLSNLLQKNFPNQKAA
VIASQVEQADVLAFNDPQILRLMNGKLPIYIRFGTVKPAAVVRPFLESWQPQQFEPIEGA
MEFANRLTKNMQTLKKWAVKENIHCLRLYDADLPDFNIAVDLYGERLHVQEYAPPKKIDP
EKAKKRFNLALQAIRAVTGLGRDAIFIKTRARQEGKNQYTKQSTASKRFIVQEGQAKILV
NLTDYLDTGLFLDHRQMRLRIAKEAKGKHFLNLYSYTSTASLHAALGGAASTTSVDLSNT
YLNWSKENFVLNGLTVDHADEQHQFFASDCFEWLKEGHEQYELIFIDPPTFSNSKKFYGT
FDVQRDHLSLIKRAMNRLTTEGTLYFSNNYRGFEMDAEILAFFDVEEITHETIGPDFKRN
QKIHRAWKITHPKM
NT seq 2205 nt   +upstreamnt  +downstreamnt
atgaatacctcttcacgtttaagcaattattgggtcacctgtgccgatggtctggaaacc
ttattagaagaagaaatcaaaggtttaggtgttcaggatattgaacgtttcccgggtcgt
ctgacctttaaaggtacactggaaaatgcgtaccgcatctgtatgtggtcgcgtctggct
tcacgtgtcctgatgccaatccacacacatgaaattgagttctcccatgatgcgcgtgat
gtggctgaagagctttatgaaggtgcaatcagctttgactggtcactaatttttgcacca
caaagtaccttcgcgattcgtctgcatgtggaacgtgatatcaaggtcaatacccagttt
gccactttgcgtgctaaagatggtgttgtggattcctttatggaagccgtgggtaaacgt
ccaagtatcgataccaaacagccagaaatcactatgtatattctggctggtaaaaaagcc
catgcctactgcctggacctttctggtgattctctgcataaacgtggctatcgtcgcttt
atgactgaagcaccaatcaaggaaaacctggcagcagcgatcctgcaaaaaggtggcctg
aaagacatcaacccggatatcgtggttgatcctatgtgtggttcaggtacctttattatt
gaatctttaatgattctgactgatcgtgcaccaggcctggtacgtcgtttcggctttaac
ggctggaatggtcatgatcatgaattgtggatgggtattaaagccgaagctgctgaacgt
cataaagctgcgctggaaaatccattaccaaaattttatgccttcgatgctgactgggaa
gcagtaaaagccaccaagcaaaatatcattgcggcaggttttgaatcagcgcttgaccag
attatgatcgaagaacgtaccttaaatgactggcctgatttccaggctgaaggcaagaaa
gtattcttcgtgaccaacccgccttatggtgagcgtttaggtgacaaggcttctaaccgt
gcgttgtacttaggtttgtctaatctgctgcaaaagaatttcccgaatcaaaaagcagca
gtgattgcctcccaagttgaacaggcagatgtcttggcgttcaatgatccgcaaattcta
cgcctgatgaacggtaaattaccgatctatattcgtttcggtacagttaaaccggctgca
gtggtacgtccattcctggaaagctggcaaccacagcaattcgagccaatcgaaggtgcc
atggaatttgccaaccgtctgaccaagaatatgcaaactctgaaaaaatgggcggtgaaa
gaaaatattcactgtctacgtttgtatgatgcagacttgcctgattttaatatcgcagta
gacctgtatggtgagcgtctgcacgttcaggaatatgccccaccgaaaaaaattgatcct
gaaaaagctaaaaaacgttttaacctggctttgcaggcgattcgtgctgtgacaggttta
ggtcgtgatgcgatctttatcaaaacccgtgctcgtcaggaaggcaaaaaccagtacacc
aaacaaagcacggcgtctaaacgttttatcgtgcaggaaggtcaggccaagattctggtc
aacctgaccgattatctggataccggtctgttcctggatcaccgtcaaatgcgtttacgt
attgccaaagaagccaaaggcaagcatttcctgaatctgtatagctatacctctacggca
agtttacatgcagcactgggtggtgcagccagtacgacgagcgtggatttgtccaatacc
tatttgaactggtcgaaagaaaactttgtattaaatggtttaaccgttgaccatgcagat
gaacaacatcaattcttcgcaagtgactgttttgagtggctgaaagaaggtcatgagcaa
tatgaactaatctttatcgatccaccaacattctctaactcaaagaaattctacggtact
tttgacgtacaacgtgaccatttgtctttgattaaacgtgccatgaaccgtttaaccact
gaaggtacactctacttctcaaataattatcgtggctttgaaatggatgcagaaatcttg
gcattctttgatgtggaagaaatcacccatgaaactatcggccctgatttcaagcgtaat
caaaagattcaccgtgcatggaaaatcacccatccaaaaatgtaa

DBGET integrated database retrieval system