KEGG   Acinetobacter schindleri: AsACE_CH01755Help
Entry
AsACE_CH01755     CDS       T04787                                 

Gene name
ahpF-1
Definition
(GenBank) alkyl hydroperoxide reductase subunit F 1
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
asj  Acinetobacter schindleri
Brite
KEGG Orthology (KO) [BR:asj00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AsACE_CH01755 (ahpF-1)
Enzymes [BR:asj01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AsACE_CH01755 (ahpF-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 K_oxygenase AlaDh_PNT_C FMO-like FAD_binding_3 Spermine_synth Cytochrom_C_2 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: APX63151
UniProt: A0A1P8PKW5
LinkDB All DBs
Position
1841349..1842914
Genome map
AA seq 521 aa AA seqDB search
MLDQNTATQLKTLLERLEGPIELIATLDASDKSAKIKELVEEIAALSDLVTARFDGTNKR
APSFGVAKAGEQPRVFFAGLPMGHEFTSLILALLQTSGYAPKVSNEVLESIKGLGIKSDF
DVFVSLSCHNCPDVVQALNLIAIYNPGTTATMIDGAFFQEEVEERKIMAVPMVFQDNNHI
GQGRMTLEEIIAKLDTNSAAKDAEKLNAKEAFDVLVIGGGPAGNTSAIYAARKGIKTGIV
AERMGGQVMDTMDIENFTSVQKTQGPKFAAEMEAHVREYGVDIMNLQRVSDIKGADETAN
GLVEVTLENGAKLESKTVILSTGARWREMNVPGEQEYKTRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLVEFDTKLRADQVLQDKLNSLPNTTVIKNALSTEVVGD
GSQVTALKYKDRATDEEHTVELAGIFVQIGLLPNTDFLKETKVELSNRGEIVINERNETN
VKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYIIRSGQ
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaatacagcaacccaattaaaaacccttttagaacgccttgaagggcca
atcgaactgatagccactttagatgcttcggataaatctgcaaaaatcaaagaacttgta
gaagaaatcgctgcactgtctgatttagtgactgcccgttttgatggtaccaacaaacgt
gcaccaagttttggtgtggctaaagccggtgaacagcctcgcgtgttcttcgcaggcctg
ccaatgggtcatgagttcacatcgctgattctggcattgctgcaaacttcgggttatgca
ccgaaagtatcgaatgaagttcttgaatcgatcaaaggtttgggcatcaagtctgacttt
gatgtgtttgtctctttaagctgtcataactgtccggatgtggttcaggcactcaacctg
attgcaatctataacccgggtacaacagctaccatgatcgatggtgctttcttccaggaa
gaagttgaagaacgcaaaatcatggccgtaccaatggtgttccaggacaacaaccatatt
ggccagggtcgtatgactttggaagaaatcattgccaaactggataccaattctgctgcc
aaagatgcggaaaagctgaatgccaaagaagcgtttgatgttcttgtgattggtggtggt
cctgcggggaatacctctgcaatctacgcagcgcgtaaaggcattaaaaccggtatcgtg
gctgaacgtatgggcggtcaggtcatggataccatggacatcgagaacttcacttcagtg
caaaagacccaaggtccaaaatttgctgccgagatggaagcacacgtacgtgaatatggt
gtcgacatcatgaacctgcaacgtgtatctgacatcaagggtgcagatgaaactgccaac
ggtctggttgaagtgactttagaaaatggtgccaagcttgaatctaaaactgtaatcctg
tcaaccggtgcacgctggagagagatgaatgttccgggtgagcaggaatacaaaacccgt
ggtgttgcctactgtccacactgtgatggtccactgttcaaaggcaaacgtgttgcggtg
attggtggtggtaactcgggtgtagaagctgcgatcgaccttgctggtattgttgagcat
gtcaccctggtggaatttgataccaaactacgtgcggatcaggtacttcaggacaaactc
aatagcttgccgaacaccacggtgatcaagaatgccctttcaacagaagtagtgggcgat
ggttcacaggtaactgcactgaaatacaaagaccgtgcgaccgatgaagaacatacggtt
gagcttgcagggatcttcgttcagatcggtttgttaccgaatacggatttcctgaaagaa
accaaagttgagttaagcaaccgcggtgagattgtgattaacgagcgcaatgaaaccaat
gtgaaaggtgtatttgctgcgggtgactgcaccacagtaccttacaagcagatcatcatt
gccacaggtgaaggcgcgaaagcatcactgtctgcatttgactacatcatccgttcgggt
cagtaa

DBGET integrated database retrieval system