KEGG   Acinetobacter schindleri: AsACE_CH02435Help
Entry
AsACE_CH02435     CDS       T04787                                 

Gene name
mdh
Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
asj  Acinetobacter schindleri
Pathway
asj00020  Citrate cycle (TCA cycle)
asj00270  Cysteine and methionine metabolism
asj00620  Pyruvate metabolism
asj00630  Glyoxylate and dicarboxylate metabolism
asj00680  Methane metabolism
asj01100  Metabolic pathways
asj01110  Biosynthesis of secondary metabolites
asj01120  Microbial metabolism in diverse environments
asj01130  Biosynthesis of antibiotics
asj01200  Carbon metabolism
Module
asj_M00009  Citrate cycle (TCA cycle, Krebs cycle)
asj_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
asj_M00012  Glyoxylate cycle
asj_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:asj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AsACE_CH02435 (mdh)
   00620 Pyruvate metabolism
    AsACE_CH02435 (mdh)
   00630 Glyoxylate and dicarboxylate metabolism
    AsACE_CH02435 (mdh)
  09102 Energy metabolism
   00680 Methane metabolism
    AsACE_CH02435 (mdh)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AsACE_CH02435 (mdh)
Enzymes [BR:asj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AsACE_CH02435 (mdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: APX63793
UniProt: A0A1P8PMP7
LinkDB All DBs
Position
complement(2541546..2542532)
Genome map
AA seq 328 aa AA seqDB search
MKQPVRVAVTGAAGQIGYSLLFRIASGEMLGKDQPVILQLLEIPVEKAQQALKGVMMELD
DCAFPLLAGMIGTDDPKVAFKDADYALLVGSRPRGPGMERADLLKVNGEIFIGQGQALNE
VASRDVKVLVVGNPANTNAYIAMKSAPDLPAKNFTAMLRLDHNRALTQLAQKAGVAVSDI
ENMTVWGNHSPTMYADYRFANVNGESLKDKINDAAWNKDVFLPTVGKRGAAIIEARGLSS
AASAANAAIDHMRDWALGTNGKWVTMGIPSDGSYGIPEGVMFGFPVTTENGEYKIVQGLE
IDEFSRERINVTLNELEEERAAVADMLN
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaacctgttcgcgttgccgttactggcgctgctggtcaaattggttacagccta
ttattccgtatcgctagcggtgaaatgttgggtaaagaccaaccagttattcttcaatta
ttagaaattcctgttgagaaagctcaacaagcgcttaaaggcgtgatgatggaacttgac
gactgtgctttcccattattggcaggcatgatcggtactgatgatcctaaagttgcattc
aaagatgctgactatgcattgttagtaggttctcgtccacgtggtcctggtatggaacgt
gctgaccttcttaaagtaaacggcgaaatctttatcggtcaaggtcaagcactgaacgaa
gttgctagccgtgacgttaaagtgcttgttgtgggtaaccctgcgaatacaaatgcttac
atcgcaatgaaatctgcgccagatcttccagcgaaaaacttcacagcaatgttacgtctt
gaccacaaccgtgcgttgactcaacttgcgcaaaaagcgggtgttgcagtttctgacatc
gaaaacatgactgtttggggtaaccactctccaacgatgtatgctgactaccgttttgca
aacgtaaacggcgaaagcttgaaagacaaaatcaacgatgctgcatggaacaaagacgta
ttccttccaacagttggtaaacgtggtgctgcgatcattgaagcacgtggtctgtcttct
gctgcttctgctgcaaacgctgcaatcgatcatatgcgcgattgggctcttggcactaac
ggtaaatgggtaacgatgggtattccttctgacggttcttatggtatccctgaaggcgta
atgttcggtttccctgtaacgactgaaaacggtgaatacaaaatcgttcaaggtcttgaa
atcgacgaattcagccgtgaacgtatcaatgttacattgaacgaacttgaagaagagcgc
gcagcagtggctgacatgcttaactaa

DBGET integrated database retrieval system