KEGG   Acinetobacter schindleri: AsACE_CH02597Help
Entry
AsACE_CH02597     CDS       T04787                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
asj  Acinetobacter schindleri
Pathway
asj00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asj01100  Metabolic pathways
asj01110  Biosynthesis of secondary metabolites
asj01130  Biosynthesis of antibiotics
asj01230  Biosynthesis of amino acids
Module
asj_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:asj00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AsACE_CH02597 (aroK)
Enzymes [BR:asj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AsACE_CH02597 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 AAA Cytidylate_kin AAA_5 AAA_22 TsaE AAA_16 AAA_28 Cytidylate_kin2 RNA_helicase dNK AAA_24 Mg_chelatase CHDNT ABC_tran AAA_14 Ploopntkinase3 CoaE AAA_30
Motif
Other DBs
NCBI-ProteinID: APX63949
UniProt: A0A1P8PN56
LinkDB All DBs
Position
complement(2691077..2691613)
Genome map
AA seq 178 aa AA seqDB search
MPSKEFESLPNIYLVGPMGAGKTTVGRHLAELLGREFLDSDHEIERKTGATIPWIFEKEG
EQGFRSRETVVIDELTSRPQLVLATGGGAVTQAPNREYLKQRGIVVYLYTPVEIQLQRTY
RDKNRPLLQVENPEQKLKDLLAIRDPLYREVAHHIIETNQGAARDLAQRILNLILPKK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
ttgccaagcaaagagtttgaatccctgccaaatatctatttggtagggccgatgggggcg
ggaaagacaacagtaggacggcatttagcagaattgttaggacgagaatttctggatagt
gatcatgaaattgagcgtaaaacaggtgcaacgattccctggatctttgaaaaagagggt
gagcagggctttcgcagtcgtgagacggttgtcatcgatgagttaacttcacgaccacag
ttggttttggccacaggtggtggtgcggtgactcaggcgcctaaccgcgaatatctgaaa
cagcgaggcatcgttgtttatctctacactcctgtagaaatccagctccagcgaacctat
cgcgacaaaaaccgtcccttattacaagttgagaatccagaacagaaacttaaagatctg
ctggcaattcgggatccgctgtatcgggaagtcgcacaccatattattgagaccaatcag
ggcgctgcacgcgatctggcacagcgtattctgaatctcatccttccgaaaaaataa

DBGET integrated database retrieval system