KEGG   Acinetobacter schindleri: AsACE_CH02675Help
Entry
AsACE_CH02675     CDS       T04787                                 

Definition
(GenBank) sensor histidine kinase protein
  KO
K02668  two-component system, NtrC family, sensor histidine kinase PilS [EC:2.7.13.3]
Organism
asj  Acinetobacter schindleri
Pathway
asj02020  Two-component system
Brite
KEGG Orthology (KO) [BR:asj00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AsACE_CH02675
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:asj01001]
    AsACE_CH02675
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:asj02022]
    AsACE_CH02675
   02035 Bacterial motility proteins [BR:asj02035]
    AsACE_CH02675
Enzymes [BR:asj01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AsACE_CH02675
Protein kinases [BR:asj01001]
 Histidine kinases
  NtrC family
   AsACE_CH02675
Two-component system [BR:asj02022]
 NtrC family
  PilS-PilR (type 4 fimbriae synthesis)
   AsACE_CH02675
Bacterial motility proteins [BR:asj02035]
 Pilus system
  Twitching motility proteins
   AsACE_CH02675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA PAS_8 PAS HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: APX64020
UniProt: A0A1P8PND6
LinkDB All DBs
Position
2772047..2773612
Genome map
AA seq 521 aa AA seqDB search
MSQRSSYSELNQYLLGTWYAAYRLIISTGLLLIFVLTYPEHTSDLEYPKLYHYVLSSFIA
IALIQLFVLKYFKKFVQQQLTGIFIVDVCALSLLTLATNGTNLQLSMLFVITIFAASILL
NAQKALVITLIAVISVIYQHFITSLFTLSSLGNIGNSAILAFMFFVVYGIGQIAVRRFQI
LENVNFSQSMELYRLQNINRYILEQIETGYLVLDENCHVVLSNPAACHLLGIQQMYAHDT
FPLYQSQPDLFELIRFEDLENGERFQFESQQSRFNIHVQVQKLIVPHQTLMLLVLQDARK
LNQQVQQLKLAALGQLSASIAHEIRNPLAAIVQANDLLPGCEQDQQQVLHSMISKQATRI
NRIIEDTLNMVKNKETHPVSIQLNEFIPQCIHEDLADIADQIKLNIDMRLDIQFDEAQLR
QVLVNLLRNAVRHNDPAVGYVELKVHPYEHKVWIDVRDFGQGVAPADQSLLFKPFFSTSI
NGTGLGLYLSHSFCEANQAQLNYIQQEQGACFRISCQRITV
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcgatcttcttattcagagcttaaccaatatctgctgggcacttggtatgcg
gcataccgcctgatcatcagtactggtttactgctgattttcgtgctcacttatcctgag
cacactagcgatttagaatatcccaagctgtatcattatgtactgagtagcttcattgct
atcgccttgatccagctttttgttctgaagtattttaagaaatttgttcagcaacagctg
accggtatttttattgtcgatgtctgtgcactcagcctgctgaccttggccacgaatggc
accaatctacagctcagtatgctattcgtgattactatctttgccgcttccattttactg
aatgcacaaaaagcgctggtgattaccttgattgcggtcatcagtgtgatttaccagcat
ttcatcaccagcctgtttaccctttcctctctgggtaatatcggcaatagcgccatattg
gctttcatgttttttgtggtctatggcatcgggcaaattgcagtccgacgtttccagatc
ttggaaaatgtcaatttttcccagtccatggaactttatcgtctacaaaatattaaccgt
tatattctggaacagattgagactggttatctggttctcgatgaaaactgtcatgtggtg
ctgagtaatcctgctgcctgccacttgcttggcatccagcaaatgtatgcacatgacacg
tttccattgtaccagtcacaaccagatctgtttgagctgatccgctttgaagatctggaa
aatggcgaacgctttcagtttgaatcccagcaaagccgtttcaatattcatgttcaggta
caaaaactgattgtaccgcatcaaactttaatgttgctggtgctgcaagatgcgcgaaaa
cttaatcaacaagtccagcaattaaaactggcggcactcgggcaactttctgccagtatt
gcccatgagattcgtaatccgcttgcagcgattgttcaagccaatgatctgttacctggc
tgtgaacaggaccagcagcaggtgttgcatagcatgatcagcaagcaggcaacacgaatc
aaccggattatcgaagacacgctgaatatggtgaagaataaagagactcatccagtatct
attcagctgaatgaatttattccacaatgtatccatgaggatttggctgatattgctgat
cagattaagctgaatattgatatgcgactggatatccagtttgatgaagcccagctacgt
caagtattggtcaatttattgcgtaatgccgtgcggcataacgatccagccgtaggctat
gtagaattaaaagttcatccttatgaacataaagtctggattgatgtacgggattttggt
cagggtgttgcgcctgccgatcagagtctgctgtttaaaccatttttcagcacttcaatt
aatggtacaggactagggctatatttatcccacagtttctgtgaggccaatcaggcccag
ctgaattatatacaacaagaacagggtgcctgcttccggattagctgccagcgcatcact
gtttaa

DBGET integrated database retrieval system