KEGG   Arcobacter skirrowii: EI285_06830Help
Entry
EI285_06830       CDS       T05743                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ask  Arcobacter skirrowii
Pathway
ask00473  D-Alanine metabolism
ask00550  Peptidoglycan biosynthesis
ask01100  Metabolic pathways
ask01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ask00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EI285_06830
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EI285_06830
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EI285_06830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ask01011]
    EI285_06830
Enzymes [BR:ask01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EI285_06830
Peptidoglycan biosynthesis and degradation proteins [BR:ask01011]
 Precursor biosynthesis
  Amino acid ligase
   EI285_06830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 RimK CPSase_L_D2
Motif
Other DBs
NCBI-ProteinID: AZL54306
LinkDB All DBs
Position
complement(1293989..1295029)
Genome map
AA seq 346 aa AA seqDB search
MKIAIVFGGISFEHEISIVSSIAMKDVLKDELIYIFIDKNRDLYEIPSSKINSKLFSSAE
YLKFDKVFLKKGGFYKVSGLFKKEQNIDFDVVLNLSHGGDGEDGVLSSVLDFYNIPFIAP
RTEACVVSSNKFITKGYAQSVDVKTLPYKYYTKNDSIKVDMFPVILKPVKLGSSIGVSIV
KNQEELAYALDVAFEFDDAIIIEPFISGVKEYNLAGTKVNGEFIFSIIEEPQKAEFLDFD
KKYLDFSRTSKALEVDLGEKLNSEIKESFKKIYNTLFEGSIIRCDFFVVEDKVYLNEINS
IPGSMANYLFEDFQDLFTKVASNLPKKKFIPINYEYVNKIQVAKGK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatagcaatagtttttggtggtataagttttgagcatgagatttcaatagtaagt
tcaattgccatgaaagatgttttaaaagatgagttaatatatatatttatagataaaaat
agagatttatatgagattccaagttctaaaataaattcaaaactatttagtagtgcagag
tacttaaaatttgataaagtttttttaaaaaagggtggattttataaagtatctggacta
tttaaaaaagagcaaaatattgattttgatgtagttttaaatctatcacatggtggagat
ggagaagatggagttttatcttcagttttagatttttataatatcccttttatagctcca
agaacagaagcttgtgtagttagttcaaataaatttattacaaaaggatatgcacaaagt
gttgatgtaaaaactctaccttacaaatactatacaaaaaatgatagtataaaagttgat
atgtttccagttatcttaaaaccagtaaagctaggtagctctattggagtatctattgta
aaaaatcaagaagagttagcttatgctcttgatgttgcttttgagtttgatgatgcaatt
ataattgagccttttattagtggagtaaaagagtataacctagctggtacaaaagtaaat
ggagagtttattttctcaattattgaggagccccaaaaagctgagtttttggattttgat
aaaaaatatttagatttttcaagaacatcaaaagctttagaggttgatttaggtgagaaa
ttaaacagtgagataaaagagagttttaaaaaaatttacaacactctttttgaaggttca
ataataagatgtgatttttttgtagttgaagataaagtatatttaaatgagataaattca
attccaggatctatggcaaactatttgtttgaagattttcaagatctttttacaaaagtt
gcttcaaatttacctaaaaagaagtttattcctataaattatgagtatgtaaataaaatt
caagttgcaaaaggaaagtag

DBGET integrated database retrieval system