KEGG   Aequorivita sublithincola: Aeqsu_1100Help
Entry
Aeqsu_1100        CDS       T02132                                 

Definition
(GenBank) NAD-dependent aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
asl  Aequorivita sublithincola
Pathway
asl00010  Glycolysis / Gluconeogenesis
asl00053  Ascorbate and aldarate metabolism
asl00071  Fatty acid degradation
asl00280  Valine, leucine and isoleucine degradation
asl00310  Lysine degradation
asl00330  Arginine and proline metabolism
asl00340  Histidine metabolism
asl00380  Tryptophan metabolism
asl00410  beta-Alanine metabolism
asl00561  Glycerolipid metabolism
asl00620  Pyruvate metabolism
asl00625  Chloroalkane and chloroalkene degradation
asl01100  Metabolic pathways
asl01110  Biosynthesis of secondary metabolites
asl01120  Microbial metabolism in diverse environments
asl01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:asl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aeqsu_1100
   00053 Ascorbate and aldarate metabolism
    Aeqsu_1100
   00620 Pyruvate metabolism
    Aeqsu_1100
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Aeqsu_1100
   00561 Glycerolipid metabolism
    Aeqsu_1100
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Aeqsu_1100
   00310 Lysine degradation
    Aeqsu_1100
   00330 Arginine and proline metabolism
    Aeqsu_1100
   00340 Histidine metabolism
    Aeqsu_1100
   00380 Tryptophan metabolism
    Aeqsu_1100
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Aeqsu_1100
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Aeqsu_1100
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Aeqsu_1100
Enzymes [BR:asl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Aeqsu_1100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFL80598
UniProt: I3YUD0
LinkDB All DBs
Position
1180500..1182053
Genome map
AA seq 517 aa AA seqDB search
MQATTTSFGIEEALEQLGIKDVNHGTSTGNKWFPGGEEIASYSPVNGELIGKVTSTTKEE
YEQVIASAQKAFLSFRAMPAPQRGEIVRQFGNKLREMKEPLGKLVSYEMGKSLQEGYGEV
QEMIDICDFAVGLSRQLNGQTIPSERPGHVMREQWHSLGIVGIISAFNFPVAVWAWNTAL
AWVCGDVCVWKGSEKAPLCTVACQNIIAGVLKENNLPEGISSIINGDYKVGEMMTTDSRI
PLISATGSTRMGRIVGAKVAERFGKSLLELGGNNAIIITPTADLKVVVPGAVFGAVGTCG
QRCTSTRRLIIHESVYDKVRDAIVGAYKQIVIGNPLDEKNHVGPLIDKESVDTYLKAIEK
AKAEGGKVLVEGGVLEGEGFESGCYVKPAIIEAENSFKIVQHETFAPILYLIKYSGDVEN
AIDMQNGVAQGLSSAIMTNELKEAEKFLSFAGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKVYMRRQTNTVNYSDELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcaacaaccactagcttcgggatagaagaagcattggaacaattaggaattaaa
gacgtaaaccacggaacttctacaggaaataaatggtttccgggaggcgaagaaatagct
tcttattctccagtaaatggcgaattaattggtaaagtaacctccactacaaaagaagaa
tatgagcaagttattgcttctgcgcaaaaagcttttttatcttttagagctatgccagcg
ccacagcgaggagagattgtacgccaatttggtaacaaacttcgcgaaatgaaagaacca
ttaggaaaactagtttcttatgaaatggggaaatctttgcaagaaggttacggcgaagtt
caggaaatgattgacatctgcgatttcgcagttggactttcacgacaattaaacggtcaa
accattccgtctgagcgtccaggtcacgtaatgcgtgagcaatggcactctcttgggatt
gttggcattatttcagcatttaactttcctgtagcggtttgggcctggaacacagcattg
gcttgggtttgtggtgatgtttgtgtttggaaaggaagcgaaaaagctcctttatgtacc
gtagcttgccaaaacataatcgcaggtgtcttaaaagaaaacaatctaccagaaggaatt
tcttcaatcatcaacggtgattataaagttggcgaaatgatgaccacggattcaagaatt
cctctaatttctgcaacaggttctacaagaatgggccgtattgttggagcaaaagtggct
gagcgttttggaaaatcattattggaattaggtggaaacaatgccataattattactcca
actgcagatttaaaagtagttgtgccaggagccgtttttggagctgttggaacttgtgga
caacgttgtacctcaactagaagattgattattcacgaaagtgtttatgataaagtaaga
gacgcaattgttggtgcttataagcaaattgtcattggaaatccgttagatgaaaaaaat
cacgttggcccattaatcgataaagaatctgttgacacttatttaaaagcaattgaaaaa
gcaaaagccgaaggcggaaaagttctcgttgaaggtggcgttttagaaggtgaaggtttt
gaaagtggatgctacgtaaaaccagcaatcattgaagctgaaaacagttttaaaatcgta
caacacgaaacatttgctcctattttatacttaatcaaatacagcggcgatgtagaaaat
gctatcgatatgcaaaacggggttgcacaaggtttatcatctgcaattatgaccaatgaa
ttaaaagaagctgaaaagtttttatcatttgcagggtcagattgcggtattgctaatgta
aacattggtacttcaggcgcagaaattggtggtgcttttggtggtgaaaaagaaacaggt
ggaggccgtgagtctggatctgatgcttggaaagtatatatgagaagacaaacaaataca
gttaattactctgacgaattacctttggcacagggaattaagtttgatttgtaa

DBGET integrated database retrieval system