KEGG   Aequorivita sublithincola: Aeqsu_1724Help
Entry
Aeqsu_1724        CDS       T02132                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
asl  Aequorivita sublithincola
Pathway
asl00010  Glycolysis / Gluconeogenesis
asl00020  Citrate cycle (TCA cycle)
asl00620  Pyruvate metabolism
asl01100  Metabolic pathways
asl01110  Biosynthesis of secondary metabolites
asl01120  Microbial metabolism in diverse environments
asl01130  Biosynthesis of antibiotics
asl01200  Carbon metabolism
Module
asl_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aeqsu_1724
   00020 Citrate cycle (TCA cycle)
    Aeqsu_1724
   00620 Pyruvate metabolism
    Aeqsu_1724
Enzymes [BR:asl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Aeqsu_1724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 QRPTase_N RNA_pol_Rpc4 PYNP_C RnfC_N Zip Cwf_Cwc_15 DUF2052 DUF5308 SLC12 Paramyxo_ncap RR_TM4-6 RPN2_C
Motif
Other DBs
NCBI-ProteinID: AFL81204
UniProt: I3YW36
LinkDB All DBs
Position
1852030..1853805
Genome map
AA seq 591 aa AA seqDB search
MAEVINMPRLSDTMEEGTVATWLKKVGDTVKEGDILAEIETDKATMEFESFHEGTLLHIG
LNEGETAPVDTLLAIIGKKDEDISDLIGGKSSDKKEISKEDESKDEKKSSDKKKDKSEDE
EEDDDSSEKDANEKEESDDEDSDEDGKSESSSDSAELPEGVEIITMPRLSDTMTEGTVAS
WLKKEGDKVEEGDILAEIETDKATMEFESFYSGTLLKIAIDEGDSSPVDAVLAIIGPKGT
DFSGLLENYKKGGKSSSKKETSSEEKSSKEDKKEDKKEEKKSSDNASEKEGTKKETTLDK
KSESSQTTNEGRIFASPLAKVLAEEKGINLRQVNGSGENGRIIKSDIENYQPAAGGGEAY
TPVGTESFEEVKNSQMRKTIAKRLAESKFSAPEYYLTVELDMDYAIAAREAINADPDVKI
SFNDMVIKACAMALRKHPQVNSQWTPEATRIAKHIHIGVAVAVDEGLLVPVLKFADQMTF
SQIGRHVKELAGKARNKKITPAEMEGSTFTVSNLGMFGITEFTSIINQPNSAILSVGAIV
QKPVVKNGQIAVGNTMIVTLACDHRTVDGATGAKFLQTLRQYIENPVTMFV
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaataaacatgccgcgtttgagcgacacgatggaagaaggaacggtagca
acctggcttaaaaaagtaggcgataccgtaaaagaaggcgatattcttgccgaaattgaa
accgataaagccacgatggagtttgagtcttttcacgaaggaacattgcttcacattggt
ctcaatgaaggtgaaaccgcgccagtggatactcttttggctattattggaaaaaaagac
gaagatatttcagatttaattggcggaaaatcttcggataagaaagaaatatcgaaggaa
gatgaatccaaagatgaaaaaaaatcatctgataaaaagaaggataaatctgaagatgag
gaagaagatgatgattcttcagaaaaagatgctaatgaaaaagaggaatctgacgacgaa
gattcagacgaagatggaaaatctgaaagttcttcagattctgctgaattaccagagggc
gttgaaataattacaatgccacgactaagcgatacaatgaccgaaggaactgttgcatct
tggctcaaaaaagaaggtgataaagtagaagaaggcgatattcttgccgaaattgaaacc
gataaagccacgatggaatttgaatcattctattcaggcacattactcaaaatagctata
gatgaaggcgattcttctcctgttgatgcagttcttgctataattggcccaaaaggaact
gatttttctggtctattggaaaattataaaaaaggaggaaagtcttcaagcaaaaaggaa
acttcttcagaagaaaagtcttccaaagaagataaaaaagaagataaaaaagaagaaaag
aaaagttctgataatgcttcagaaaaagaaggaactaagaaggaaactactttagataaa
aaatctgagtcttcacaaactacaaacgaaggccgaattttcgcttcgcctttagctaaa
gttttggctgaagaaaaaggaataaatctacgtcaagttaacggaagcggcgaaaatgga
cgtatcataaaaagtgatattgagaactaccagccagctgctggtggcggagaagcttac
actccagtaggaaccgaaagttttgaggaagtgaaaaactcccaaatgcgtaaaacaatt
gcaaaacgtttggctgaatctaaattctctgcaccagaatattatttaactgttgagttg
gatatggattacgcaattgccgctcgtgaagcgattaatgcagatccagatgtaaaaata
tcttttaacgatatggttataaaagcctgtgcgatggctttaagaaaacatccgcaagta
aatagtcagtggactccagaagcaaccagaatcgcaaagcatatccacattggtgtggca
gttgcggttgatgagggattattggttcctgttctaaaatttgcagaccaaatgaccttt
tctcaaattggcagacatgtaaaagaacttgctggaaaagcgcgaaataaaaaaattaca
ccagccgaaatggaaggcagtacgtttacagtttcaaatcttggaatgtttggaatcact
gaattcacatctattataaaccaaccaaattccgcaattttatctgttggcgcaattgtt
caaaaaccagttgttaaaaatggtcaaattgcagttggtaatacaatgatagtaactttg
gcctgcgatcacagaactgtggatggcgcaacgggtgcgaaatttttacaaacattacga
cagtatattgagaatcctgtaacgatgtttgtttaa

DBGET integrated database retrieval system