KEGG   Aequorivita sublithincola: Aeqsu_1975Help
Entry
Aeqsu_1975        CDS       T02132                                 

Definition
(GenBank) NhaP-type Na+(K+)/H+ antiporter
  KO
K11105  cell volume regulation protein A
Organism
asl  Aequorivita sublithincola
Brite
KEGG Orthology (KO) [BR:asl00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asl02000]
    Aeqsu_1975
Transporters [BR:asl02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   Aeqsu_1975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_C
Motif
Other DBs
NCBI-ProteinID: AFL81447
UniProt: I3YWS9
LinkDB All DBs
Position
2119416..2120894
Genome map
AA seq 492 aa AA seqDB search
MDLTIENILLIGSLLLFISIIAGKTSYKFGVPTLVLFLGIGMLAGEDGIGGISFDDPQIA
QLIGIISLNFILFSGGLDTDWKAVKPIMKEGLALSTLGVLLTAVGLGTFVYYVTDFTIYE
SLLLGSIVSSTDAAAVFSILRSKNLALRANLRPTLEMESGSNDPMAYVLTIAFLGLVINQ
DKGLASMIPLFFQQMILGTIAGFGFGKLSKIIINRIKLDFEGLYPVLVIALMFITFSVTD
FVGGNGFLAIYICALYLGNQYLIHKKTILKMYDGLAWLMQIVLFLTLGLLVFPSQIVPVI
GIGLIISLFLILVARPAAVFISLIPFKMKLRRRFYISWVGLRGAVPIVFATYPLLAGIDK
ANMIFNIVFFISLTSILIQGTTLSVVAKWLKVSIPSEEKILTPSEKFLEEHPKTEMREIG
IANGNKVVGKKIVDIEFPKTAIIAMIKRDEKYITPNGSTAIKEDDVLIVLSESKKGIKKV
YKALKIREFSSA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
ttggatctaaccattgaaaacattctgcttattggctcgctcttactttttataagtatt
atagcgggtaaaacttcatataaatttggcgttcccaccttagtgcttttcttggggatt
ggaatgcttgctggtgaagatggtattggcggaattagcttcgacgatcctcaaattgcg
caattaataggtataatatcattaaattttattcttttttctggtgggctcgatacagat
tggaaagcggtaaaacctataatgaaagaaggtctcgcactttctacccttggcgtttta
ttaacggctgtgggtttgggaacttttgtttattacgttaccgactttaccatttatgaa
agtttgctccttggcagtatagtatcatctacagatgctgctgcagtattttccatatta
cgttcaaaaaaccttgcgctccgtgccaatttacgtcccacgttagagatggaaagcggt
agtaatgacccaatggcttatgtgctaaccattgcttttttagggttagtaattaatcaa
gacaaaggcttagcatccatgattccgttattttttcagcaaatgattctcggtaccatt
gccggttttggttttgggaaattaagcaagattatcatcaacagaattaaattagatttt
gaaggtttatacccagtgcttgtaatagctttaatgtttattaccttttccgtgaccgat
tttgtgggagggaatggttttcttgctatctacatttgtgcgctctatctaggaaatcaa
tacttgatacacaaaaaaaccatacttaaaatgtatgatggtttggcttggttgatgcag
attgtacttttcttaaccttggggcttttggtttttccttcgcagattgttcctgtgatt
ggcatcggactaattatatccttgtttttaatattggtggcacgtcctgcggctgttttt
attagtcttattccctttaaaatgaaattgcgcagacgattttatatttcgtgggttggt
ttacgaggagcagtgcctattgtatttgcaacatatccattgttagcaggtattgataag
gcgaatatgatttttaatatcgtgtttttcatttccctaacctctattttgattcaagga
actaccctttcagtagttgctaaatggttaaaagtgagcattcccagcgaagaaaaaata
ttgactccttcagaaaaatttcttgaggaacatcccaaaactgaaatgcgggagataggt
attgcaaacggaaataaagttgtaggtaaaaaaattgtggatattgaatttcctaaaact
gcgattatagcaatgattaaaagagatgaaaaatacataacaccaaatggcagtactgca
attaaggaggatgatgtgttaatcgtgctttcagaatctaaaaaaggaatcaagaaagtg
tataaggctttaaaaatcagagagttttcgtctgcataa

DBGET integrated database retrieval system