KEGG   Actinomyces slackii: NCTC11923_00646
Entry
NCTC11923_00646   CDS       T06783                                 

Definition
(GenBank) Uncharacterised protein
  KO
K20370  phosphoenolpyruvate carboxykinase (diphosphate) [EC:4.1.1.38]
Organism
asla  Actinomyces slackii
Pathway
asla00620  Pyruvate metabolism
asla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NCTC11923_00646
Enzymes [BR:asla01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.38  phosphoenolpyruvate carboxykinase (diphosphate)
     NCTC11923_00646
SSDB
Other DBs
NCBI-ProteinID: VEG74027
UniProt: A0A448KAS8
LinkDB
Position
1:complement(776620..780015)
AA seq 1131 aa
MNTAAATTSAIALRLELLGLPAPADAIQDETDRLLSPIVARQRELSRRLAHRPCATDKRI
QAFLDSYLEDAPVAPTLPHTTFVLDQPGLARALSLPVGASSFESDYVSSYRVQGGVLHNP
RNDRRTTAGVFHVAEGGLPIPDDKAAVPRDVFARLLDHALQAPEGLMTLPWGAEQPEPAR
TWASLLLRPVVVPEVPGYSTARSMEIRFIAPGGLVSNLDFVEGIFGNGGDPYLPENDASL
APESWTGHTGCVILAPHLTGLTKKELGLPSWDEATERQRRDGMCYRSEDERYNNGQAFKC
CARDQRGVVVTIIADNYFGYCKKEVKTQIGYSANLFGCVEEEHAGGAIALPRYNLGQEYT
EKHTPAEATVAGAVELGAGRFQAQPEGHAVDLSDDSIIIVPGGAHYSMRSQTVTWQGPEG
PHSIPLLAGRTYVTPSGYRIHAKHREGEPTQWHLVGTAPWATHAHKPATVSGGGKSEISK
SLLDAFVHGEAYIGDVEADLDAVQALLDRDYSERFAQAEANGKDHRPILSEDRSLGSVIK
LFTPSSAFNEDHNAFLGRIPAHIKELVFTVKRYYQPSWGTRWRNHFSVGLINGRQGNSLR
LDGEVVKVNMLRVGFEADGSWRLLSLRPDFSPAAKVQTEDDITASITVPGNLRATAGASV
SRKFVTNCERLLFQRPDDAIVRGYDKQTEADMAQPPAEGVFISNFEPLTPADARAMIDDA
PGLARFTAPMQDLVRRAAQAEEGSFWVSSANPRLVDGVPSKNPRYLQVRPDLAQPREAAL
TSLSTHLYHAMPLGEPLRHYVDVVAAGRRNNPPEDGVPPLCAYNPLHYMELPELFMEFIS
SMTGKSPSTTGAGSEGALTKAPFNALPAIYDLNAALLSYALGGYDGWLSSAGYIGPKVKV
AHDISLLIPEIFSRMSPEERDAGALIRHGFLERMEDFTHEGRTIEASRLGYRMNQAFAST
FFGRIFLHPDVVFTEEMLRPELQDPEVFATSVEVIVTTHKAVAEHYRADGSLEWAVPPLR
ALLEIMMDGTSREGWTLADPQFRALFEREAILASDWYAARLDAKVTRDARQAHQAIEDLT
RFNTTEHNEEAAARLDIEGRLAAARAWLDEVTSPAYREHLVGTLGLQPDLA
NT seq 3396 nt   +upstreamnt  +downstreamnt
atgaacacagccgcggccacgacctctgccatcgcactgcgcctggagctgctggggcta
cccgcccccgctgacgccatccaggatgagaccgaccgcctcttgtcccccatcgtcgcc
cgccagcgcgagctctcgcgccgcctggcccaccggccctgcgccaccgacaagcgtatc
caggccttcctcgactcctacctggaagacgcccccgtcgccccgaccctgccccacacc
accttcgtcctggaccagcccggcctggcccgcgccctgtcccttccggttggcgcctcc
agcttcgagtccgactacgtgtccagctaccgcgtgcagggcggcgtcctgcacaacccc
cgcaatgaccggcgcaccacggccggcgtcttccacgtggccgagggcggcctgcccatc
ccggacgacaaggccgccgtgccacgcgacgtgttcgcccgcctcctggaccacgccctc
caggcccccgagggcctcatgaccctgccctggggcgccgagcagcccgagcccgcccgc
acctgggcctccctgctgctgcgccccgtcgtcgtccccgaggttcccggctactccacc
gcccgcagcatggagatccgcttcatcgcaccgggcggactggtctccaacctggacttc
gtcgaggggatcttcggcaatggcggggacccctacctgccggagaacgacgcctccctg
gcccccgagtcctggacggggcacaccggctgcgtcatcctggccccccacctgaccggc
ctgaccaagaaggagctgggcctgcccagctgggatgaggccaccgagcgccagcgccgc
gacggcatgtgctaccgcagcgaggacgagcgctacaacaacggccaggccttcaagtgc
tgcgcccgcgaccagcgcggcgtcgtggtgaccatcatcgcggacaactacttcggctac
tgcaagaaggaggtcaagacccagatcgggtactcggccaacctcttcggctgcgtggag
gaggagcacgccggcggcgccatcgccctgccccgctacaacctcggccaggagtacacc
gagaagcacacgcccgccgaggccacggtggccggcgccgtcgagctgggggcgggccgc
ttccaggcccagcccgagggccacgccgtcgacctgagcgacgactccatcatcatcgtg
cccggcggcgcccactactccatgcgcagccagacggtcacctggcagggccccgagggc
ccccactccatccccctgctggccggccgcacctacgtgacccccagcggctaccgcatc
cacgccaagcaccgcgagggcgagcccacccagtggcacctggtgggcaccgccccctgg
gccacccacgcccacaagccggccacggtctccggcggcgggaagtcggagatctccaag
tccctcctggacgccttcgtccacggcgaggcctacatcggggatgtcgaggccgacctc
gacgccgtccaggcccttctggaccgcgactactccgagcgcttcgcccaggccgaggcc
aatggcaaggaccaccgcccgatcctgtccgaggatcgctccctgggcagcgtcatcaag
ctcttcaccccctcctcggccttcaacgaggaccacaacgccttcctggggcgcatcccc
gcccacatcaaggaactggtcttcacggtcaagcgctactaccagccctcctggggcacg
cgctggcgcaaccacttctccgtgggcctcatcaacgggcgccagggcaactccctgcgc
ctggacggggaggtcgtcaaggtcaacatgctgcgcgtgggcttcgaggccgacggctcc
tggcgactgctgtccctgcgcccggacttctccccggccgccaaggtccagaccgaggat
gacatcaccgcctccatcaccgtgccgggcaacctgcgcgccacggccggggcctcggtg
tcgcgcaagttcgtgaccaactgcgagcgcctgctcttccagcggcccgacgacgccatc
gtgcgcggatacgacaagcagaccgaggcggacatggcccagccccccgccgagggcgtg
ttcatctccaacttcgagccgctcacgcccgccgatgcgcgcgccatgatcgacgacgcc
ccgggcctggcccgcttcaccgcccccatgcaggacctggtgcgccgtgccgcccaggca
gaggagggcagcttctgggtctcctcggccaacccccgactggtcgacggcgtcccctcg
aagaacccccgctacctccaggtccgcccggatctggcccagccgcgggaggcggccctg
acctccctgtccacccacctctaccacgcgatgccgctgggcgagccgctgcgccactac
gtcgacgtcgtggccgccgggcgccgcaacaacccgccggaggacggcgtgccgccgctg
tgcgcctacaacccgctgcactacatggagctgcccgagctgttcatggagttcatctcc
tccatgaccggcaagtcgccctccaccaccggggcgggatccgagggcgcgctgaccaag
gcccccttcaacgcgctgccggccatctacgacctcaacgcggccctgctgtcctacgcc
ctggggggctatgacggctggctgtcctctgcggggtacatcggccccaaggtcaaggtg
gcccacgacatctccctgctcatccccgagatcttctcgcgcatgagccccgaggagcgc
gacgccggggccctcatccgccacggcttcctggagaggatggaggacttcacccacgag
gggcgcaccatcgaggcctcccgcctgggctaccgcatgaaccaggccttcgcctcgacc
ttcttcggccgcatcttcctgcaccccgatgtggtcttcaccgaggagatgctgcgcccc
gagctgcaggacccggaggtcttcgccacctcggtggaggtcatcgtcaccacgcacaag
gcggtggccgagcactaccgggccgacggctccctggagtgggcggtcccgccgctgcgc
gccctgctggagatcatgatggacggcaccagccgcgagggctggaccctggccgatccg
cagttccgcgccctgttcgagcgcgaggccatcctggcctcggactggtacgcggcccgc
ctggatgccaaggtgacccgggacgcccgtcaggcccaccaggccatcgaggacctgacc
cgcttcaacaccaccgagcacaatgaggaggcggccgcgcgcctggacatcgagggccgt
ctggccgccgcccgcgcctggctggacgaggtcacctccccggcctaccgcgagcacctg
gtggggaccctgggcctccagcccgatctggcctga

DBGET integrated database retrieval system