KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0565Help
Entry
MOUSESFB_0565     CDS       T01857                                 

Definition
(GenBank) protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Brite
KEGG Orthology (KO) [BR:asm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:asm01001]
    MOUSESFB_0565
Enzymes [BR:asm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MOUSESFB_0565
Protein kinases [BR:asm01001]
 Serine/threonine kinases: Other
  Bacterial family
   MOUSESFB_0565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Haspin_kinase Kinase-like Pkinase_fungal RIO1 Fructosamin_kin
Motif
Other DBs
NCBI-ProteinID: BAK79707
LinkDB All DBs
Position
647620..649602
Genome map
AA seq 660 aa AA seqDB search
MIGKVIGGRYEIIEKLGEGGMANVYKAKCKILKRFTTIKILKQELTNDEEFVRKFKDEAM
EVAKLSDNNIVKVYDIGVEDNLHYIVMEYIDGKTLKEYISERGVLSIKEALDFSIQICNG
LVIAHDIELIHRDIKSQNILVSNHGNIKVTDFGIAKSSDSATITNSGKILGSAYYISPEQ
ARGNFVDCRSDIYSFGVVMYEMFTGRLPFTHGTPVNVALQHIQVDPVEPMDIVKKLPIGI
NNLIIKCLQKNPALRYQNSKELRDDLKALQNNKKHFVTRCNMLDKTTVMSAVTPPIPTKL
KKNNVFRNIVIVLLLILAIIVLIMSFKFSGLVGKFSADISVPSFLGKTGVQYERELEELG
LNYKISGYVESDLEKNFVVDIYPKEGTIVKKGDTIKIVLSDGVELVDVPNIVNMTLDKAR
LVLQREGLTIGNIEERFSDVYERGVIMIQNPSQTSKIGKNETISVVISRGSETELVVVPQ
FVGKDIVEAQNLAVLNGINIKLKSVDTTNQENDKKIFYQSVPDGIEIKPTVEIELSYYNY
VKKQFDDDTSPDKDLDKEPDDTVEDNVKDELTSSESNDETDEGNKKNLIGQSETINQEGN
MTKVPDIIDYTVKDAREILKESDLELDANNFDDTDVIKKIDCLVGDEVISGSQIKIEEVY
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgataggtaaggtaataggtggcagatatgaaataatagaaaaacttggtgaaggtgga
atggctaatgtatataaggccaagtgtaaaatattaaagagatttactacaattaagatt
cttaaacaggagcttactaatgatgaggaatttgtacgtaagtttaaggatgaggcaatg
gaagttgctaagttatctgataataatatagtaaaggtttatgatataggagtcgaagat
aacttgcactatattgtaatggaatatatagatggaaagactttgaaggagtacataagt
gaaagaggagtactttctataaaggaagcattagattttagtatacaaatttgtaatggg
ttggttattgcccatgatatagaattaatacatagagatataaagtctcaaaatatttta
gtttcgaatcatggtaatataaaagtgactgattttggaatagcaaagtcctctgattct
gccacaataactaattcaggaaagatattaggatcggcatattacatatctccagaacag
gctcgtggaaatttcgtagattgtagaagtgatatttattcttttggtgttgtgatgtat
gaaatgtttacaggaaggttaccatttactcatggaacgccggttaatgttgcgttgcaa
catatacaagtagatccagttgaacctatggatatagttaagaaattacctattgggata
aataatcttataataaagtgtcttcaaaagaatcctgcattaagatatcaaaattctaag
gagttaagagatgatctgaaagcactgcaaaataataaaaagcactttgttacaagatgt
aatatgcttgataaaaccacagttatgtctgcagtaacaccaccaattccaactaagtta
aagaaaaataatgtatttagaaatattgtcatcgttcttttgcttatactcgctattatt
gttttaataatgagttttaaatttagtggattagttggaaaattttctgctgatatcagt
gttccttcatttttggggaaaactggggttcaatatgagcgagagttggaagaattaggt
ttaaattataaaatttctggatatgtggaaagtgatttagaaaagaattttgtagttgat
atttatcctaaagagggaacaatagtaaaaaaaggagatacgattaaaattgtattaagt
gatggagttgaactcgtagatgttcctaatatagttaatatgactttagataaagctaga
ttggtattgcaaagagaaggacttactattgggaatatagaagaaagatttagtgatgta
tatgagcgtggtgtaataatgattcaaaatcctagtcagacttcaaaaataggtaagaat
gaaactatatctgttgttataagtaggggatctgaaacggaacttgttgttgttcctcaa
tttgtaggtaaggatatagttgaggcacagaatttagctgtattgaatgggattaatata
aaattgaagtcggttgatacaactaatcaagagaatgataagaaaatattttatcagtct
gttccagatggaattgagattaagccaacagttgagattgagttaagttattataactat
gttaaaaagcaatttgatgatgatacttctccagataaagatttagataaagaaccagat
gacactgttgaagataatgttaaagatgagcttaccagcagtgaaagtaatgatgagact
gatgaaggcaataaaaaaaatttaataggacaaagtgaaactattaatcaagaaggtaat
atgactaaggtaccagatataattgattacactgtgaaggatgcacgtgaaattcttaag
gagagtgatcttgaattagatgctaacaattttgatgatacagatgttattaaaaaaatt
gattgcttagttggagatgaagtgatttcagggtcgcaaataaagatagaagaagtatat
tga

DBGET integrated database retrieval system