KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_1014Help
Entry
MOUSESFB_1014     CDS       T01857                                 

Gene name
natA
Definition
(GenBank) ATP-binding transport protein NatA
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Brite
KEGG Orthology (KO) [BR:asm00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asm02000]
    MOUSESFB_1014 (natA)
Transporters [BR:asm02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    MOUSESFB_1014 (natA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran DUF4162 AAA_21 DUF87 SMC_N Thymidylate_kin AAA_16 SbcCD_C AAA_30 AAA_23
Motif
Other DBs
NCBI-ProteinID: BAK80156
LinkDB All DBs
Position
complement(1152119..1153009)
Genome map
AA seq 296 aa AA seqDB search
MSLKIINLNKTYGDKKVVNRVNFEVEAGRAYGILGRNGAGKTTTIKMILDIISKDSGQVL
FKNKELNVIGEKIGYLPEEKSLYYKSTVWNHLFYFSRISGLDVKESKTKINYWVEKFQLE
EYINKPIETLSKGNQQKVQIISTIIHDPDILIFDEPFSGLDPVNSETLRNIVIELVNSGK
YIIFCTHQTHYIEEFCDKISIFKNGIQTIEGNLFNIKKSYGRNKLILEIDGNLPNLKIYG
VKGIVKNKNTYEIEILNENVAGDILNILYNNRIKIFNFGLKYKSLHEIFLNTAGDL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaagattataaacttaaataagacatatggtgataaaaaagtcgtaaataga
gttaattttgaagttgaagcaggtagagcatatggaatattgggtagaaatggggcaggt
aagactactaccattaaaatgattttggatataataagtaaagatagtggtcaggtttta
tttaaaaataaagagttaaatgttattggtgaaaaaataggatatttgccagaagaaaag
agcctttattataagagcacggtatggaatcatttgttttatttttcaagaatatctgga
cttgatgttaaggaatcaaaaactaaaattaattattgggtagaaaagtttcaattagaa
gagtatatcaataagccaatagaaaccttatctaagggtaatcagcagaaagtacaaata
atttcaactataattcatgatccagatattttaatatttgatgagccatttagtggattg
gatccagtaaattctgaaacattaagaaatatagtaattgaacttgttaatagtggtaaa
tatattatattctgtactcatcaaacgcattatatagaggaattttgtgataagatatct
atttttaaaaatggaattcagaccattgaaggaaatttatttaatattaaaaagtcctat
ggcagaaataaattaattcttgagatagacgggaatttgccgaatttaaaaatatatggt
gttaaaggaatagtaaaaaataagaatacttatgagatagagatattaaatgaaaatgtt
gcaggtgatatattaaatattttgtacaataataggattaagatttttaactttggttta
aaatataaatcattacatgaaatttttttgaatacggctggtgatttatag

DBGET integrated database retrieval system