KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_1215Help
Entry
MOUSESFB_1215     CDS       T01857                                 

Gene name
ddl2
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
asm00473  D-Alanine metabolism
asm00550  Peptidoglycan biosynthesis
asm01100  Metabolic pathways
asm01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:asm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MOUSESFB_1215 (ddl2)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MOUSESFB_1215 (ddl2)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MOUSESFB_1215 (ddl2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:asm01011]
    MOUSESFB_1215 (ddl2)
Enzymes [BR:asm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MOUSESFB_1215 (ddl2)
Peptidoglycan biosynthesis and degradation proteins [BR:asm01011]
 Precursor biosynthesis
  Amino acid ligase
   MOUSESFB_1215 (ddl2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK ATP-grasp_4 CPSase_L_D2 ATPgrasp_ST GARS_A ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: BAK80357
LinkDB All DBs
Position
complement(1380304..1381206)
Genome map
AA seq 300 aa AA seqDB search
MSKKLKLGVLYGGISSEREVSINTGKQIIYALNKEKYDVEGILLNNKEDVFKCKGFDFVF
IALHGEFGEDGQVQSILDAMGIRYNGSDFLTSSLCMNKYLVKKVLSDYDIPMAKGIIVDR
DYDLLNIDLNFPVIIKPNIGGSSVGVVICKTKDKLFENVKESFLYDDHLLIEEFIGGQEI
TCGILNGESLPILKIVPRNNDFFNYKSKYDNTTIEEPIDLPVELDNKIKEISKKCHSVLN
CRVYSRVDFILRDGIPYFLEINTLPGMTEGSLFPKIARLIGLDFKSLLDNIIENSNNKYI
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaaaacttaaattaggtgttctatatggagggatatcatctgagcgtgaagtt
tctataaatacagggaaacaaataatttatgcattaaataaggaaaagtatgatgttgaa
gggatattgttaaataataaagaggatgtgtttaaatgtaagggatttgattttgtattt
attgctttacatggagaatttggtgaagatggacaagttcagagtattttagatgctatg
gggattagatataatggatctgactttttaactagttcactatgtatgaataaatattta
gttaagaaagtattgagtgattatgatatacctatggcaaagggaattattgtagatagg
gattatgatttattaaatattgatttaaattttccagttattattaaaccaaatattgga
ggatctagtgttggggtagttatttgtaaaactaaagataaattatttgaaaatgtaaag
gagtcctttttatatgatgatcatctgttaattgaagaatttataggaggacaggaaata
acttgtggaatattaaatggggagtcgcttccaatacttaaaatagttcctaggaataat
gatttttttaattataagtctaagtatgataatacaactattgaggaacctatagattta
cctgttgagttagataataagattaaggaaatttcaaaaaaatgtcacagtgttttgaat
tgtagggtttattcgagagtagatttcatattgagagatggaattccatattttcttgaa
attaatacattacctggaatgactgaaggaagtctttttcctaaaatagctaggcttata
ggattagatttcaaatcattattagataatataatagaaaattctaataataaatatatt
taa

DBGET integrated database retrieval system