KEGG   Alligator sinensis (Chinese alligator): 102367978Help
Entry
102367978         CDS       T02922                                 

Gene name
ME3
Definition
(RefSeq) NADP-dependent malic enzyme, mitochondrial
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00620  Pyruvate metabolism
asn01100  Metabolic pathways
asn01200  Carbon metabolism
asn03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    102367978 (ME3)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    102367978 (ME3)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     102367978 (ME3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 102367978
NCBI-ProteinID: XP_025071426
UniProt: A0A3Q0HHJ8
LinkDB All DBs
Position
Unknown
AA seq 542 aa AA seqDB search
MAFTLEERLQLGIHGLLPPCFLSQDVQVLRVMKTYETKSSDLDKYIVLMTLQDRNEKLFY
RVLTSDIERFMPIVYTPTVGLACQQYGLAFRRPRGLFITIHDKGHIAAMLNSWPEEDIKA
VVVTDGERILGLGDLGSYGMGIPVGKLALYTACSGVHPQQCLPVLLDVGTDNEALLNDPL
YIGLKHKRVRGKQYDDLIDEFMQAVANKYGMNCLIQFEDFANANAFRLLNKYRNRYCTFN
DDIQGTASVAVAGIFAALRITKNKLSNHKFVFQGAGEAAMGIASLIIMAMEKEGVSQEEA
IKKIWMVDSKGLIVKGRSHLNHEKEMFAQDHPNVKTLEEVVQRVKPTAIIGVAAIAGAFT
EQILKDMAAFNERPIIFALSNPTSKAECTAEQCYRLTEGRGIFASGSPFPKVTLPNGQTF
FPGQGNNAYVFPGVALGVIACGVRHISDDLFLTTAESIAEEVTEEHLAEGRLYPPLSTIR
DVSFKIAVKIVDYAYKHNLASWYPEPKEKEAFVRNLIYSPEYDSFVIDNYRWPQDAMQIQ
AV
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcctttacacttgaagagaggctacagcttgggattcatggtctgcttcctccctgc
ttcttgagccaagatgttcaagttctccgtgtcatgaaaacctatgagaccaaatccagt
gatctagataaatacattgtccttatgacactacaagacagaaacgagaagcttttttac
cgagttctgacatcagacattgagagattcatgcccatagtttatactccgacagttggc
ctggcctgtcagcagtatggcctggctttcagaagaccacgtgggctgtttatcaccatt
catgacaaaggccatattgcagccatgctcaactcctggccagaagaagatataaaggct
gttgtggtgactgatggagagagaattttgggcctaggagatctgggcagctacggcatg
ggaatcccagtggggaagctcgccttgtacactgcctgcagtggcgttcacccgcaacag
tgtctccctgtcctgcttgatgttggcacagacaatgaggctctcctgaatgatccactt
tacattggactgaagcacaagcgggtacgtgggaaacaatacgacgacctgattgatgag
tttatgcaagcagttgctaacaagtatggaatgaactgtttaatccagtttgaagatttt
gccaatgccaatgctttccgtctcctcaacaaataccgcaacagatattgtacattcaat
gatgacattcagggtaccgcctctgttgcagtagctggcatctttgcagccttaagaatc
acgaagaacaaactatccaaccacaaatttgttttccagggagctggagaggctgcgatg
ggcatagcttctctcatcattatggccatggaaaaggaaggcgtttcccaagaggaagcc
atcaaaaaaatctggatggtggactccaaagggctgattgtcaaggggaggagtcacctg
aaccatgagaaagagatgtttgctcaagatcatcccaatgtgaaaacgctagaggaagtt
gtgcaaagagtgaagccgacagctattataggtgtggcagccattgcaggggctttcact
gaacagattttgaaggacatggcagctttcaatgagaggcccatcatatttgccttaagc
aaccccacaagtaaagcagagtgcacagctgagcagtgctatcgcctcacagagggccga
ggtatatttgcaagtgggagtcctttccctaaagtaaccctgcccaatggacagaccttc
ttccccggccaaggaaacaacgcctatgtgttcccaggagtggcactgggagtcatcgcc
tgtggagtccggcatatctctgatgatctcttcctcaccactgcagagtctattgctgaa
gaggtcacagaagagcacctggcggaagggagattatatccacccttgagtactatcaga
gatgtgtccttcaaaattgctgttaagattgttgactacgcctacaaacataatcttgct
tcctggtatccagaacccaaagaaaaggaagcctttgtcaggaacctcatctacagcccg
gagtatgattcatttgtcattgataactacagatggccccaagatgccatgcagattcaa
gctgtgtag

DBGET integrated database retrieval system