KEGG   Alligator sinensis (Chinese alligator): 102368723
Entry
102368723         CDS       T02922                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04012  ErbB signaling pathway
asn04068  FoxO signaling pathway
asn04110  Cell cycle
asn04115  p53 signaling pathway
asn04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102368723 (CDKN1B)
   04068 FoxO signaling pathway
    102368723 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102368723 (CDKN1B)
   04115 p53 signaling pathway
    102368723 (CDKN1B)
   04218 Cellular senescence
    102368723 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102368723
NCBI-ProteinID: XP_006031858
UniProt: A0A1U7SJW2
LinkDB
Position
Unknown
AA seq 170 aa
MESLIFKLIGEQQKGKKMMVWRPVKTNCVRRNLFGPVDHEQLQKDFQQLLRSGVEGAKQK
WNFDFLREIPAEGLLQWEELQGHEVPAFYHSCVVGEARKPLQLLNRPMGKEARAHQFAKV
TLTEKSKAPKKIVGKSPEVKKQRQASVTDYYSAKKRVKTNTKAASENVAF
NT seq 513 nt   +upstreamnt  +downstreamnt
atggaatcgctgatctttaagctcatcggagagcagcagaagggcaaaaagatgatggtg
tggagaccagtgaagacaaactgtgtgcgaaggaacctctttggtcctgtggaccacgag
cagctgcagaaggacttccagcagctactgcgcagcggtgtagagggagccaagcagaag
tggaactttgacttcctacgagaaataccagctgaggggctcctgcaatgggaagagcta
cagggccatgaggtcccagccttttaccacagctgtgtggtaggagaggctcgcaagccc
ttgcagctcttgaaccggcccatgggcaaggaagccagggctcaccagtttgccaaggtg
acactgactgagaaatccaaagctcccaagaaaattgtaggcaagagcccagaagtgaag
aaacaaagacaggcttccgtcacagattactactcagcgaagaagagagtcaaaactaac
acaaaagctgcttcagaaaatgtggctttctga

DBGET integrated database retrieval system