KEGG   Alligator sinensis (Chinese alligator): 102368755Help
Entry
102368755         CDS       T02922                                 

Gene name
GALNT9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9 isoform X1
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00512  Mucin type O-glycan biosynthesis
asn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    102368755 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:asn01003]
    102368755 (GALNT9)
Enzymes [BR:asn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     102368755 (GALNT9)
Glycosyltransferases [BR:asn01003]
 O-Glycan biosynthesis
  Mucin-type
   102368755 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 102368755
NCBI-ProteinID: XP_025051424
LinkDB All DBs
Position
Unknown
AA seq 545 aa AA seqDB search
MGPTSANSLTWKLEEVTAAQTGLAKPMGLVEGPGGLGQGGMAATLRDDSHESETKYEEYG
YNAQLSDRISLDRSIPDYRPKKCKQMTYPDDLPQISVVFIFVNEALSVILRSVHSVVNHT
PSHLLKEIILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNNKREGLIRARIQGWKAATA
PVVGFFDAHVEFNTGWVEPALTRIKEDRKRIILPAIDNIKYNTFEVQQYANAAHGYNWGL
WCMYIIPPQDWLDKGDESAPIRTPAMIGCSFVVNREYFGEIGLLDPGMEVYGGENIELGM
RVWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNI
PMTNPGVDFGDVSERIALRQRLQCRSFKWYLENVYPEMRIYNNTITYGEVRNSKASGYCL
DQGAEDDDKAILYPCHGMSSQLVRYSSEGLLQLGPLGSTAFLPDSKCLIDDGKGRTPTLK
KCEDILRASQRLWDFTQNGPIISRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWI
KHGRH
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggggcccacttctgcaaattcgcttacgtggaaattggaagaagtaactgcagcccag
acaggtttagccaagccaatgggactagttgaaggtccaggaggcctgggccagggagga
atggctgctactctgagagatgacagtcatgagtctgagactaagtatgaagaatatggt
tacaatgcccagcttagtgaccggatatccctggacaggtccattcctgactacagacca
aaaaagtgcaagcagatgacctaccctgatgacctgccccagatttcggtggtgtttatt
tttgtaaacgaggcactgtctgtcatcttgcgctctgtgcacagtgttgtgaaccatact
ccatcccatttgctcaaggagatcattctggtggatgacaacagtgataacgttgagctg
aagtttaatctggatcagtatgtcaataagagatacccaggcctggtgaaaatagtgcgt
aacaacaaacgggaaggattgattagagccagaatccaaggctggaaagcggcaaccgct
cccgttgttggtttcttcgatgctcatgttgagttcaacactggctgggtggagccagca
cttacccggatcaaagaagaccgaaagcggatcatcctcccagctattgataatatcaag
tacaacacattcgaagtgcagcaatatgccaatgcagcccacggttataactggggactc
tggtgcatgtatataatccctccccaggactggcttgataaaggggatgagtctgctccc
atcaggaccccagcaatgattgggtgttcgtttgtggtgaaccgggagtactttggtgag
attggtctgcttgaccctggaatggaagtctacgggggagaaaatattgaactgggcatg
cgggtctggcagtgcggaggaagcatggaagtcttaccttgctctagagtggctcacatt
gaacgcacaaagaaaccttacaacaatgacattgactactatgcaaagcgcaatgccttg
cgagctgctgaggtctggatggatgacttcaagtcacacgtttacatggcatggaacatc
ccaatgacgaacccaggagttgactttggagatgtttcagaaagaatagctctacggcag
cgactgcaatgccggagttttaagtggtacttggagaatgtttatcctgaaatgaggatt
tacaataatacaatcacttatggagaggttcgtaacagcaaagctagcggctactgctta
gaccaaggagcagaagatgatgacaaagcaatcctctatccgtgccatggaatgtcctcc
cagctcgttcgctacagctccgaagggctcctgcagttagggcctctgggctccaccgcc
tttcttccagactctaaatgtctcattgacgatgggaaaggcaggacccctactctgaag
aaatgtgaagacattttgagggcttcacaaagactctgggattttacacagaatggccca
atcatcagcagagacactggacggtgtcttgaagtggaaatgtcaaaggatgccaacttt
gggcttagactcgtggtacaaaggtgctcggggcaaaagtggatgattagaaactggata
aaacatggtcggcattga

DBGET integrated database retrieval system