KEGG   Alligator sinensis (Chinese alligator): 102369126Help
Entry
102369126         CDS       T02922                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00590  Arachidonic acid metabolism
asn01100  Metabolic pathways
asn04370  VEGF signaling pathway
asn04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102369126 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102369126 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102369126 (PTGS2)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102369126 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 102369126
NCBI-ProteinID: XP_006023935
UniProt: A0A1U7RIC2
LinkDB All DBs
Position
Unknown
AA seq 605 aa AA seqDB search
MLLLYASVIALVLAAGRAANPCCSNPCQNRGVCLTTGFDKYECDCTRTGYYGENCTTPEF
FTWLKITLKPTPNTVHYILTHFKGVWNIINNIPFLRDAIMRYVLTSRSHLIDSPPTYNSE
YGYKSWEAFSNLSYYTRALPPVARDCPTPMGVKGKKELPDSKLVVEKFLLRKKFIPDPQS
TNIMFTFFAQHFTHQFFKTDHHKGPAFTKGLGHGVDLNHIYGETLDRQLKLRLHKDGKLK
YQMIGGEMYPPTVKDTQAEMMYPPHVPEHLQFSVGQEVFGLVPGLMMYATIWLREHNRVC
DILKQEHPEWDDERLFQTTRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQKFQY
QNRIAAEFNTLYHWHPLLPDTFQIHDQEYTFQQFLYNNSIMLEHGLSHMVKSFSKQIAGR
VAGGKNIPAAVQKVAKASIDQSRQMRYQSLNEYRKHFLMKPFKSFEELTGEKEMAAELEE
LYGDIDAMELYPGLLVEKPRPGAIFGETMVELGAPFSLKGLMGNAICSPEYWKPSTFGGR
VGFEIVNTASLQKLICNNVKGCPFTAFHVLNPESTEAATINVSTSNSAIDDINPTLLLKE
RSAEL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgctctacgcttccgtgatcgcgctcgtcctggccgccggccgcgcagctaat
ccttgctgctcaaatccatgtcagaacagaggagtttgtttgacaacaggctttgacaaa
tacgaatgtgactgtacaaggaccgggtattatggggaaaactgcactacacccgaattc
tttacgtggttgaaaatcacattgaagcctactcccaacaccgtccactacatcctcaca
cacttcaagggagtctggaatattataaacaacattcctttcttacgtgatgccatcatg
cgatatgtattgacatcaaggtcgcatttgattgacagtcccccaacatacaacagtgaa
tacggttacaaaagctgggaagccttttccaacctttcctactatacaagagcccttccg
ccagtagcacgagactgcccaacacccatgggtgttaaaggtaaaaaggaactcccggat
tccaagttagttgtggagaagtttctgctgaggaaaaaatttattccagatccacagagc
acaaatattatgttcacattctttgctcaacacttcacccaccagttctttaagactgat
caccacaaaggaccagccttcacaaaaggccttgggcatggggttgatttgaaccatatc
tatggagagactttggacagacagcttaagctcaggcttcataaagatgggaagctaaag
tatcagatgattggtggagaaatgtaccctccaacagtgaaggatactcaagcagaaatg
atgtatcctcctcatgttcctgagcatctacaattctctgtaggacaggaggtgtttggc
ctggtcccaggtttaatgatgtatgctaccatatggctcagggagcacaaccgggtctgt
gacatccttaagcaggagcatccagaatgggatgatgaacggttattccaaactaccaga
ctcatattgataggggagaccatcaagattgtcattgaagactatgtgcaacacttgagc
ggctaccatttcaagctgaagtttgatcctgagcttctgtttaaccaaaagtttcagtac
cagaacagaattgcagctgaattcaacactctataccactggcacccacttctacctgac
acgttccagatacatgaccaggaatacacattccagcagtttctttacaacaactccata
atgctggagcatggcctttcccacatggtgaaatccttctccaagcaaattgctggcagg
gttgctgggggtaaaaacattcctgcggcagtacagaaagttgccaaggcatctattgac
caaagcagacagatgagataccaatccttgaacgaataccggaaacacttcctcatgaaa
ccctttaaatcatttgaggaacttacaggagaaaaagaaatggcagccgaactggaagag
ctttatggagacattgatgctatggagctgtatcctggtctgttagtagaaaagccccgt
ccaggagccatctttggtgagactatggtagagcttggagcaccattctcgttgaaaggc
ctgatgggaaatgctatctgctctcctgagtactggaagcctagcacttttggtggaaga
gtaggctttgaaatagtcaacacggcctccctgcaaaaactcatctgcaacaacgtaaag
ggttgtccctttacagcttttcatgtcctaaaccctgaatccactgaagcagcaactatt
aatgtcagtacctcaaactcggcaatagatgatatcaaccccacattactactgaaagaa
agatctgcagaattatag

DBGET integrated database retrieval system