KEGG   Alligator sinensis (Chinese alligator): 102369133
Entry
102369133         CDS       T02922                                 

Gene name
CACNA1E
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent R-type calcium channel subunit alpha-1E
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04010  MAPK signaling pathway
asn04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102369133 (CACNA1E)
   04020 Calcium signaling pathway
    102369133 (CACNA1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:asn04040]
    102369133 (CACNA1E)
Ion channels [BR:asn04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102369133 (CACNA1E)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 102369133
NCBI-ProteinID: XP_025061945
UniProt: A0A3Q0GUR5
LinkDB
Position
Unknown
AA seq 2442 aa
MLGLGPCTASAHTLSETSSFTTGGVTELDTDSQRYVLALPEEETWRKHRLGLMQTTQSCN
LLEPESLTEALVSRTASFDALYELRSREGEGSLGFEGGSTFDLGLSQYIPVSPDVIKRRR
GGLIEQRDIIKAHEAHKMQSTPQARRKEWEXARSGEARLGILRSAHGGSXQSRGRPGAAA
PAGGTPGAFKQTKAQRARTMALYNPIPVRQNCFTVNRSLFLFGEDNVVRKYAKKLIDWPP
FEYMILATIIANCIVLALEQHLPGDDKTPMSRRLEKTEPYFIGIFCFEAGIKIVALGFVF
HKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGIPSLQIV
LKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHRACYANNSGELEELDPPHPCGV
QGCPPGYECKEWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALGATWNWLY
FIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGYRAWIDKA
EEVMLAEENKNAGTSALEVLRRATIKRNRTEAMNRDSSDEHCVDISSVGTPLARSSIKSA
KVDGASYFRHKERLLRISVRHMVKSQVFYWIVLSLVALNTACVAIVHHNQPLWLTHLLYY
AEFLFLGLFLLEMSLKMYGMGPRLYFHSSFNCFDCGVTVGSIFEVVWAIFRPGTSFGISV
LRALRLLRIFKITKYWASLRNLVVSLMSSMKSIISLLFLLFLFIVVFALLGMQLFGGRFN
FMDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYFIILTLFG
NYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNMPTVERDR
RRRHHMSMWEPRSSQLRERRRRHHMSVWEQRTSQLRRHMQMSSQEGINKDEPPLLNPHAS
IFRRKKPGENVASDKPEEEQGGKAEQPQVEGLEQPTTGTNVSASEDKRSPSPRAKRERDQ
WHQKSCHGNCDPTEQDGSGGGGSGIEDRARLRQSQRRSRHRRVRTEGKEPAGALESRSTS
QDAGLEDANPAEGQQKRNEGEKEENLIQGEQAGEELKRTNGVPASEAEVPGATEDRSPPK
VPHELNQGNNVSLAEQDCSGVDTSDQALLGGLQMEMSRAISRSEPDLSSITANTEKATES
TTIMIDVQESTVVQISNKTDGEASPLKEAETKEDEEEAEKKKRKKEKSSETGKAMVPHSS
MFIFSTTNPVRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSDRNKVTVLRYFD
YVFTGVFTFEMVIKMIDQGLILQDGSYFRDLWNILDFIVVVGALVAFALANALGTNKGRD
IKTIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQL
FKGKFFYCTDSSKDTEKDCIGNYVDHEKNKMEVKCREWKRHEFHYDNIIWALLTLFTVST
GEGWPQVLQHSVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQG
DKMMEECSLEKNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIAL
NTVVLMMKYYSAPYTYELALKYLNIAFTMVFSLECVLKIIAFGFLNYFRDTWNIFDFITV
IGSITEIILTDTKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYV
CLLIAMLFFIYAIIGMQVFGNIKLDEGSHINRHNNFRSFLASLMLLFRSATGEAWQEIML
SCLEGKGCEPDTTATSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLT
RDSSILGPHHLDEFVRIWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRL
VLMNMPVAEDMTVHFTSTLMALIRTALDIKIAKGGADWQQLDSELQKEILTIWPHLSQKM
LDLLVPMPKTSDLTVGKIYAAMMIMDYYKQSKAKKQRQQLEEQKNAPMFQRMEPSSLPQE
IISNAKALPYLQQDTLSGLSSRSGFPSLSPLSPQQIFQLACMDPTHGQYQEHQSLEPEVR
EFKRVQPSNRGNYLPVDTQERAVSGRASSMPRLTVDPQVVTDTSSMRRSFSTIRDKRTNS
SWLDEFSMERSSENTYKSRRRSYHSSLQLTARRLNADSGHRSDTHRSGGRERGRSKERKH
LLSPDISRCNSEERSPQADCESPERRRQSRSPSEGRSQTPNRQGTGSLSESSIPSISDTS
TPRRGRRQLPPVPPKPRPFISYTSMMQHAGDTSPQPDESEGGSPLLSKALETNDTCLTES
SSSLQGKQSRHSTPQHYISEPYLALHDDSHASDCGEEETLTFEAAVATSLGRSNTIGSAP
PMRHSWQMPNGHYRRRRRGAAQGVVCGASIDVLSDTEEDDKC
NT seq 7329 nt   +upstreamnt  +downstreamnt
atgcttggactcgggccgtgcactgccagtgctcacacactctccgagaccagctccttc
acgaccggtggggttaccgagctagacaccgactcccagcgctatgtcctggccctccca
gaggaagagacatggcgcaagcaccggctaggcctgatgcaaaccacccagtcctgcaac
ctgctagagcccgagagcctgacagaggctctggtctcccgcaccgccagttttgatgcc
ctctatgagctgcgatcccgggagggagaagggagcttgggctttgagggaggcagcacg
ttcgacctagggctgagccagtatattccagtgagccctgatgtcatcaagcgccggagg
ggcgggttgatcgaacagcgggacatcatcaaggcccacgaggctcacaagatgcagagc
acaccgcaggcaagacgcaaggagtgggagtaagctagaagcggggaagctagactggga
attctcaggtcagctcatggaggcagttaacagagcaggggccgcccgggcgccgcggcc
cccgccgggggcaccccgggagccttcaagcaaaccaaagcccagagggccaggactatg
gctctgtacaaccccatcccggtccggcagaactgcttcaccgtcaacagatccctcttt
ctcttcggggaggataacgtggtgaggaaatacgccaagaagctcatcgactggcctccc
tttgaatacatgattctggccacgatcattgcgaactgcatcgtcctggcgctggagcag
cacctgccgggggatgacaagacacctatgtcccgaagattagagaagacagagccttac
ttcatcgggatcttttgttttgaagctgggattaaaatcgttgctctgggattcgttttc
cacaagggctcatacctgcggaatggctggaacgtcatggacttcattgtggtcctcagt
ggcatccttgccacagctggaacccacttcaacacacacgtggatctgaggacgctgcgg
gcagtgcgtgtgctcagacctctgaagctcgtctcaggcattcccagtttacagatcgtg
ttgaagtccatcatgaaggccatggtacctcttctccagataggcttgctgctctttttt
gctattctgatgtttgccatcattggcctggagttctacagtgggaagctgcaccgggct
tgctacgcaaataattcaggtgaactagaagagctggaccctcctcatccctgtggagtg
caggggtgccccccgggttatgaatgtaaggagtggattggtcccaacgatgggatcact
cagtttgacaacatcctctttgctgtgttgaccgtcttccagtgcattaccatggaaggg
tggaccacagtgctgtacaataccaatgatgccttaggagccacctggaactggctgtac
ttcatccccctcatcatcatcggatccttctttgttctcaaccttgtcttgggagtgctt
tctggggaatttgccaaagagagagagagagtggagaaccgcagagccttcatgaaactg
cgacgacagcagcagattgagcgggagctgaacggctacagggcctggatagataaagca
gaggaagtaatgctggctgaagagaataaaaatgctggaacttcagctttagaagtgctc
aggagagctactatcaaaagaaaccggacagaagccatgaatcgtgactcaagtgatgaa
cactgcgttgatatttcctctgtagggacccctcttgctcgctccagcatcaagagtgca
aaagtggatggtgcctcttatttccggcacaaggagcgacttttgcgtatctccgttcgc
catatggtgaaatcccaggtgttttattggatcgtcttgagccttgtggctctcaacact
gcctgcgtggccattgtccatcacaaccagccattgtggctcacccacttgctctactat
gcagagttcctgtttcttgggctcttccttttggagatgtccttaaagatgtatggaatg
gggccacgcctttatttccactcctctttcaactgctttgactgtggggtcacagtggga
agcatctttgaagtggtgtgggccatcttcagaccagggacttctttcgggatcagtgtt
ctacgagctctccggcttctgagaatatttaaaataacaaagtattgggcatccctgagg
aatttggtggtctcactgatgagttccatgaagtctattatcagtctgctcttcctcctt
ttccttttcattgtagtctttgctctgttgggaatgcagctgtttggaggcagatttaat
ttcatggatggaactccttctgcaaactttgacacctttcctgcagccatcatgactgtg
tttcagatcctgacaggtgaggactggaacgaagtgatgtacaatgggatccgctcccag
ggaggagtccgctcaggcatgtggtcctccatctacttcatcatcctcactttgtttgga
aactacaccttgctgaatgtgttcttggccatcgctgtggacaacctggccaatgctcag
gagttgacaaaggatgagcaggaggaggaggaggcttttaaccagaagcacgccctgcag
aaagccaaggaagtcagcccgatgtctgccccaaacatgcccactgttgaaagggacaga
aggaggagacaccacatgtcgatgtgggaaccacgcagcagccaactgagagaaagaagg
aggcggcaccacatgtcagtgtgggagcagcgtaccagtcagctccgcaggcacatgcag
atgtccagccaggagggaatcaataaggatgaacctccactgctcaaccctcatgccagc
atattcaggagaaaaaagccaggtgaaaatgtagcctcagataagcctgaggaggaacag
ggaggcaaggcagagcagccacaagtggaaggcctggaacagccaaccactggcaccaac
gtcagtgccagtgaggacaagaggagcccatcccctcgagccaagagagaaagggaccag
tggcatcagaaatcgtgtcatgggaactgtgatccaactgaacaagatggcagtggagga
ggaggttcagggattgaagacagagcccggctaagacagagccagcggcgcagccggcac
cggagggtgcggactgaggggaaggagccagctggagctctggagagccggtcgaccagc
caagatgcaggcctggaggatgccaatcctgcagagggacagcagaagaggaatgaagga
gaaaaggaggagaatttgattcagggggagcaggcaggcgaggaactgaaaagaaccaat
ggagtcccagccagcgaggctgaggtccctggggccaccgaagacaggagtccacctaaa
gtccctcatgagctcaaccaggggaataatgtaagcctggctgagcaggactgcagcggt
gtagataccagtgaccaagccctgctgggcggcctccagatggagatgagcagagccatc
agcaggagtgaaccagacctctcctccatcacagccaacactgagaaagccactgagagc
accaccatcatgatcgatgtccaagagtccactgtggtacagattagcaacaagacagat
ggagaagccagccccttgaaggaggcagagacaaaagaggatgaagaagaggcagaaaag
aagaaacggaaaaaggagaaaagctcagagacgggcaaagcaatggtgcctcacagctcc
atgttcatcttcagcacgactaaccctgtgcgaagagcctgccattacattgtgaacctg
cgctactttgagatgtgcatcctcctggtgattgcagctagcagcattgcattggcagct
gaagaccctgtcctgaccaactctgacaggaataaagtgactgtcctgaggtattttgac
tatgttttcactggtgtcttcacctttgagatggttatcaagatgatagatcagggcttg
atcctgcaggatggctcctatttccgagacctctggaacatcctggacttcatcgtggtg
gtgggggctttggtggctttcgccttggcgaatgctttggggaccaacaagggccgggat
atcaaaactattaagtctctccgtgtactgcgggtcttgaggccgctgaaaactattaag
cgattgcccaaactcaaggctgtctttgactgtgttgtgacttccttgaagaatgtcttc
aacatactcattgtttacaagctcttcatgttcatctttgctgtcatcgctgtccagctt
ttcaaggggaaatttttctattgtacagacagctctaaggacacagagaaggactgcata
ggcaattatgtggaccatgagaaaaacaagatggaagtgaagtgtcgtgaatggaagcgc
catgaattccactatgacaatatcatttgggctttacttacactcttcactgtctccact
ggagaggggtggccacaggtgctgcagcattccgtggatgtgaccgaggaggaccggggg
cccagccgcagtaaccgcatggagatgtccattttttatgtggtgtattttgtggtcttc
cctttcttctttgtcaacatctttgtggctctcattatcatcacattccaggagcaagga
gacaaaatgatggaggaatgcagtctggagaagaatgagagggcatgcattgactttgcc
atcagtgccaaacctctcactcgctacatgcctcaaaaccgacataccttccagtaccgt
gtctggcactttgtggtctctccttcctttgaatacaccatcatggccatgatagctttg
aatactgtggtgctgatgatgaagtattattctgcaccctatacatacgagctggctttg
aagtacctgaacattgcatttaccatggtgttctccttggaatgtgtcctgaagatcata
gcttttggcttcttgaattatttccgggacacctggaacatctttgacttcatcactgtg
ataggcagcatcacagaaattatcttgacagacaccaagttggtaaacaccagtggcttc
aacatgagctttctgaagctgttccgggctgctcgcctcatcaaactgctccgccagggc
tacaccatccgtattctgctgtggacctttgtgcagtctttcaaggcccttccctacgtt
tgtctcttgatagctatgcttttcttcatatacgcaatcattgggatgcaggtttttggg
aatatcaaactagatgaaggaagccacataaaccggcacaacaacttccgcagcttcttg
gcctccctcatgctcctctttaggagtgccacaggtgaggcatggcaagagattatgctt
tcatgcctggaaggcaaaggctgtgaacccgacactacagcgacatctggacagaatgag
aacgagcgctgcggcactgacctggcttatgtttactttgtctccttcatcttcttttgc
tcattcctgatgctcaatctgtttgtggcggtcataatggacaattttgaatacctgact
cgggattcctccatcctggggcctcatcacctagacgaatttgtccggatctgggcggag
tatgacagagccgcatgtggccgcatccattacactgagatgtatgaaatgctgactctc
atgtcaccaccgctaggcctcggcaagagatgtccctccaaagtggcctataagaggctg
gtgctgatgaacatgcccgtggctgaagacatgactgtccatttcacctccaccttgatg
gcattgattcgaacagcgctggacataaaaattgccaaaggtggtgcagactggcagcag
ttggattcagagctgcagaaggagatcctgaccatctggcctcacctatcccagaagatg
ctggacttactagtgcccatgccaaaaacttcggacctgactgttggcaaaatatatgca
gccatgatgatcatggactattacaagcagagcaaagcaaagaagcagaggcagcaactg
gaggaacagaaaaatgcccctatgttccagcgcatggagccctcatctctgcctcaagag
ataatttctaatgccaaagctctgccttacctccagcaagacaccctgtcaggcctgagc
agccggagtgggtttccctccctgagtccactctctcctcaacagatatttcagctggct
tgtatggatccaacacatgggcagtaccaggagcaccaatcactggagccagaggttaga
gagtttaaaagagtgcagccctctaaccgtggcaactatctccccgtggacactcaggaa
cgcgctgtatctgggagggcctcctccatgccacgcctgacagtggatccccaggtggtt
acagacacgagctctatgagacgatcattctccaccatccgggacaaacgtaccaacagc
tcctggctggatgagttctccatggagcgaagtagtgagaacacttacaagtcccgccgg
cgcagttaccactcctcgctacagctgactgctcgccgcctgaatgcagactcaggccac
cggtctgatacgcatcgttcaggtggcagagaacgagggcgatccaaagaacgcaagcac
ctgctgtccccagacatctcccgctgcaactcagaggagaggagtccccaggcagactgc
gagtctccagaacggcggcgtcaatccagatcacccagcgagggcaggtcgcagacgccc
aacaggcagggcacaggttccttgagtgaaagctccatcccctctatatctgacaccagc
accccaaggagaggtcgccggcagctccctcctgtgccgcccaagccacggcctttcatc
tcgtacacctccatgatgcagcatgctggtgacacctccccacaacctgatgagagcgag
ggtgggtcccctctgctttccaaggctctggagacgaatgacacctgcctgaccgagtct
tccagctctctgcagggaaagcagagccggcactccaccccacagcactacatttcagag
ccctacctggccctgcacgatgactcccacgcctcagactgcggcgaggaggagacactc
accttcgaggctgctgtcgccaccagccttggccgctccaacacaattggctcagcccct
ccgatgaggcacagctggcagatgcccaatgggcattaccggaggaggaggagaggggcg
gcacagggggtggtgtgtggagctagcattgatgtgctaagtgatacggaggaagatgac
aagtgctag

DBGET integrated database retrieval system