KEGG   Alligator sinensis (Chinese alligator): 102369374Help
Entry
102369374         CDS       T02922                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00480  Glutathione metabolism
asn00980  Metabolism of xenobiotics by cytochrome P450
asn00982  Drug metabolism - cytochrome P450
asn00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102369374 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102369374 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    102369374 (GSTO1)
   00983 Drug metabolism - other enzymes
    102369374 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:asn02000]
    102369374 (GSTO1)
Enzymes [BR:asn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102369374 (GSTO1)
Transporters [BR:asn02000]
 Other Transporters
  Pores ion channels [TC:1]
   102369374 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C GST_C_5 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 102369374
NCBI-ProteinID: XP_006021363
UniProt: A0A1U7RW61
LinkDB All DBs
Position
Unknown
AA seq 267 aa AA seqDB search
MRGEAPRLLRKEAVPRSVPGAAALEMAGEMSRSLGKGSAAPGPVPEGLIRLYSMRFCPFA
ERTRLVLKAKGINHEIININLKNKPDWFFEKNPFGLVPVLETSKGQLIYESPITCDYLDE
AYPGEKLLPEDPYERAYQKMLLEHFSKLTPLAYKHFMAIQNGEDSTALKAEIGEKLGKFE
EILANRQSVFFGGDSVSMFDYLIWPWFERLEAFQLYDCLGHTPKLKRWMDAMKQDPAVKA
TMTDFQTFKGYLQLYVKNSPEACDYGL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgcgaggggaggcacctcggctgctacggaaggaggcggtaccgcgctcagtccccggg
gcagcagcgctggagatggccggggaaatgtcccggagcttggggaagggaagtgccgct
ccaggccccgtcccagagggactgatccgtctctacagcatgcgcttctgtccctttgca
gagcgaacccgtctcgtcctgaaagccaaaggcattaaccatgaaataataaacatcaat
ttgaagaacaaacctgactggttctttgagaaaaatccatttgggttggtacctgtcctg
gagaccagcaagggtcagctgatctatgagtctccaatcacatgcgactatttggatgaa
gcctacccgggggaaaagctcttgcctgaagacccgtatgagcgagcatatcaaaagatg
ctcttggagcacttctccaagcttacgcctctggcctacaaacatttcatggccattcaa
aatggggaggacagcactgcgctgaaagctgagatcggtgagaagcttggcaagtttgaa
gagattctagcaaatcgccagtctgtcttcttcggtggggactcggtatctatgtttgac
tacctgatctggccttggtttgaacgtctggaagctttccagctgtatgactgtctaggc
cacaccccaaagctcaagcgctggatggatgccatgaagcaggaccctgcagtcaaggct
acaatgactgacttccaaacattcaaaggctatcttcagctgtatgtcaagaatagccct
gaagcatgtgactatgggctctga

DBGET integrated database retrieval system