KEGG   Alligator sinensis (Chinese alligator): 102369422Help
Entry
102369422         CDS       T02922                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine O-palmitoyltransferase 1, muscle isoform isoform X1
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00071  Fatty acid degradation
asn01212  Fatty acid metabolism
asn03320  PPAR signaling pathway
asn04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102369422 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102369422 (CPT1B)
   03320 PPAR signaling pathway
    102369422 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:asn03029]
    102369422 (CPT1B)
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     102369422 (CPT1B)
Mitochondrial biogenesis [BR:asn03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    102369422 (CPT1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 102369422
NCBI-ProteinID: XP_014380534
UniProt: A0A1U8DS52
LinkDB All DBs
Position
Unknown
AA seq 773 aa AA seqDB search
MAEAHQAVAFQFTVTPEGFDLRLSREALKHIYLSGIAAWKKRLTRLKNTFLTGVYPATPS
SWLVVVMTTVGSLYCQVDLSMGLISHIRQCLPSSRYLSFQNRTLLSATLFSTGVWISGIL
IFRQTLKLLLSYQGWMFEPHGKMSRGTKVWAAVMKVMTGHKPMLYSFQSALPKLPVPSVQ
ATIHRQYLESVRPLLDDAQFSKMEVLAQDFQNYTAPRLQKYLVLKSWWATNYVSDWWEEY
IYLRGRGPLMVNSNYYAMDFLYVTPTSVQAARAGNSVHAILLYRRRLDREEISPVKLLGL
VPMCSSQMERMFNTTRIPGKETDILQHLVDSKHVAVYHRGRFYKLWLYYSGRLLGPRDLE
LQFQRILDDPSVPQPGEEKLAALTAGDRVPWAEARARFFGSGKNKVSLEAIERAAFFVVL
DEEEHCFHRDQEDSLDCYAKSLLHGRCYDRWFDKSFTLIVYKNGKLGANAEHAWADAPII
GHLWEFMLATDTFQLGYSEGGHCCGEPNLGLAPPQRLQWDISEECRMAIDGSYGVAQVLA
DDVDFHCFLFTDFGKGRIKRCRTSPDAFIQIALQLAHFHDKGRFCLTYEASMTRLFREGR
TETVRSCTSESTAFVRSMADPAQSRCERLRLFKLAAEKHQLMYRLAMTGAGIDRHLFCLY
LVSRYLGVESPFLAQVLSEPWRLSTSQTPQQQIRMFDLEKFSDYVSAGGGFGPVADDGYG
VSYMIGGENLITFHISSKFSSPETDSRRFGRHLRQALLDIAGLFDAPPNKVPN
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcacaccaggctgtggccttccagttcacggtcacccctgagggctttgac
ctgcgcctgagccgggaggccctcaagcacatatacctgtcaggtatcgccgcctggaag
aagcgcctcactcgcctcaagaacaccttcttgactggtgtgtaccctgccaccccctcc
agctggctggtggtcgtcatgacgacggtgggctctctatactgccaggttgacctgtct
atggggctcatcagccacatacggcaatgcctgcccagcagccggtacctgagcttccag
aacaggaccctgctaagtgccacactcttctccactggcgtctggatctcggggatcctg
atcttccggcagacactcaagctgctgctgtcttaccagggctggatgtttgagccccat
ggcaagatgagccgtggcaccaaggtctgggcggccgtaatgaaggtcatgactggccac
aaacccatgctgtacagcttccagagtgcactacccaagctgcctgttcccagcgtgcag
gccaccattcacaggcagtacctggagtctgtgcggcccttgttggacgatgcccaattt
agcaagatggaggtgctggcccaggacttccagaactacacagcgccccggcttcagaag
tacctagtgctcaagtcctggtgggcgaccaactatgtgagcgactggtgggaggagtac
atctacctgcgtggacgagggcccctcatggtgaacagcaactactatgctatggacttc
ctgtatgtgacacccacgtccgtgcaggctgcccgggcaggcaacagtgtgcatgccatc
ttgctttaccggcgccggcttgaccgcgaggagatctccccggtgaagctgctgggccta
gtgcccatgtgctcctcccagatggagcggatgttcaacaccacacgcatccccgggaag
gagacagacatcctgcagcacctagtggacagcaaacatgtggctgtgtaccaccgtgga
cgcttctacaagctgtggttatactacagcgggcggcttctggggccacgtgacctggag
ctgcagttccagcgcatcctggatgacccatcagtcccacagcctggggaggagaagttg
gcagccctcactgccggggacagggtcccatgggccgaggcccgtgctcggttctttggc
tctggaaagaacaaggtgtcattggaggccattgagcgggcagccttctttgtggtgctg
gatgaggaggaacattgcttccaccgagaccaggaggacagcctggactgttatgccaag
tccctgctgcacggccgctgctatgacaggtggttcgacaagtccttcaccctaatcgtc
tacaagaacggcaagctgggtgctaatgctgagcatgcctgggctgacgcgcccatcatc
gggcacctctgggagttcatgctggcgacagataccttccagctgggttacagtgagggg
ggccactgctgtggggagcccaacctgggcctggcacccccacaacggctgcagtgggac
atttctgaggagtgcaggatggccatcgatggctcctatggtgtagcccaggtgctggca
gatgatgtggacttccattgcttcctgttcaccgactttgggaagggccggatcaagcgg
tgccggaccagccctgatgccttcatccagattgcactgcagctggcacacttccatgac
aaaggaaggttttgcctcacctatgaggcctccatgacacgtctcttccgggagggccga
actgagaccgtgcgctcctgcaccagcgagtccacagcctttgtgcgcagcatggctgac
ccggcccagagccggtgcgaacgcctgcggctcttcaagctggcggcggagaagcaccaa
ctcatgtaccgcctggctatgaccggtgccggcatcgaccgacacctcttctgcctctac
ttggtctcgaggtacctgggcgtggagtctcccttcctcgcgcaggtgctgtccgagccc
tggcgcctgtccaccagccagaccccgcagcagcagatcaggatgttcgacctggagaag
ttctcggactatgtttcggccggcggcggcttcgggcccgtggcggacgacggctatggc
gtctcgtatatgatcgggggagagaacctgatcaccttccacatctccagcaaattctcc
agccccgagacggactcgcggcgcttcgggaggcacctgcgccaggcgctgctggacatc
gcggggctcttcgatgcgccccccaacaaggtgcctaattga

DBGET integrated database retrieval system