KEGG   Alligator sinensis (Chinese alligator): 102369627Help
Entry
102369627         CDS       T02922                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00052  Galactose metabolism
asn00500  Starch and sucrose metabolism
asn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102369627
   00500 Starch and sucrose metabolism
    102369627
Enzymes [BR:asn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102369627
    3.2.1.20  alpha-glucosidase
     102369627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102369627
NCBI-ProteinID: XP_025053830
LinkDB All DBs
Position
Unknown
AA seq 1200 aa AA seqDB search
MNCLVFQDVQYTDIDYMEEKKDFTYHKVKFKDLPNFAIDLHNHGQKYIIILVMLLFSLDP
AIIINPLINDSYDAYQRGHRKKVWVNESDGVTELIGEIWPGLTVFLDFTNPDCAAWWAEE
CKIFHVQMQYDGICNNKEEIDGYFNSLQDKMPGGEAVRECPEADVGILDGLMYSKTICMD
AVQAWGKHPDVHSLYGYSMTLTTEKAIQAVFFGKRSFILPRSTFAGSXKFIGHCLGDNFA
TWDDIKWVKPGMLEFNLFGMPYVGANICGFFFDTTELCRRWMQVRAFYPFSGNLNDEYNV
PQDPAVFGTDSLLGKTSRHYLNIRYTLLPYLYTLFYKAHIQGGMVVRPLLHEFYADEAVW
TIDRQFILGSGLLIGITPVLDPGIEKVTAYIPDAVWYDYETDGRTLWRKQLIEMYILADK
LELHACHGSGSVGNKNDIFYQFSVSNNSLQINILHRKYTDPNNLKFEEIKICGLALELTV
LTVSQNGVVQNSAXTISYNSSNKVAHITGLELELGKSYLLSWTQMLSDSERFSCHPAANA
TAKKCRAIGCIWNKQISVPNVPFCYCLPNLRYSVNQIQHTSSGLTANLSTNVKYVSCSQS
PTIPIDILFLEVKYHYDTMLQFKIYDYNSKRYEVPILLNIPNSSRSTAVSXFYEASVRNE
PFGIQVRCKSTGTVIWDTQVPGFISSDMFIQISTHLPSLYVYGFGKTEHTMFQPYMKWNT
WKMYTRLTPAGYKVNSYGFYPFFMALENDGNAYGILLLNSNTMVIYQPTPGLTYCTIGGI
VDFYMVLGPTPEFTFQEYTALIGXPLMSPYWALGFQLCHYAYRNEXSDLYMEIKAAQIPY
DVQYTDIDYMESPLDFMLSPHFSGLPKFVDKIKTKGMRFIIIINPTISCNETNYPAFAKG
LKDDVFIKWPDNSDIVWGNVWLGYPNVTVDDSITWENNQTHVEVSLYAIGIMIIFNLPPT
PSSKDLETQSFGLSFKTTCMEGQXFLPDGCPVRHYDVHNLYGWSQAKPTYNALQKITSER
GIVITRSTYSSSGRWSGHWLGDNSSAWDQLYKSVIGMMEFSFFGLSYTGTDICGFFKAAE
YEMCDRWMELGAFYPYSRNHNIKGTRRQDPVALDDRFQNISRNILNRRYTLSPYLYTLMY
EAHVHGITVVRPVLHEFVEDKTTWNVYKQFLWGPALLSPILNATSVXPYILNARWYDFTQ
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atgaactgccttgtcttccaggatgttcagtacacagatattgactatatggaagagaag
aaagactttacttaccataaagtgaaatttaaagatctccccaactttgctattgatcta
cataaccatggacaaaaatacatcatcatactggtaatgctcttattttctctggaccct
gccattatcataaacccactcattaatgatagctatgatgcctatcaaagagggcataga
aagaaagtctgggtaaatgaatcagatggagtaacagaactcattggagagatttggcca
ggtttgactgtgttcctggatttcaccaatccagactgtgctgcttggtgggctgaagaa
tgcaagatatttcatgttcaaatgcaatatgatgggatttgtaataacaaggaagagatt
gatggctactttaattctctgcaggacaagatgcctggtggagaagctgtgagggaatgc
cctgaagcagatgttgggattctggatggactcatgtattcaaagacaatttgcatggat
gcagtgcaagcttggggcaagcaccctgatgttcacagtctatatggatattctatgacc
ttgactactgaaaaagccatccaagctgttttttttggaaaaagaagcttcattcttcct
aggtctactttcgctgggtcatagaaattcataggacattgtctgggggataattttgca
acttgggatgacattaaatgggtgaaaccaggcatgctggaatttaacctctttgggatg
ccttacgttggagcaaacatttgtgggttcttctttgataccacagaactttgcagacgg
tggatgcaagttagagcattttacccattttctgggaatctcaatgatgaatataatgtg
cctcaggaccctgctgtatttggtacagattctctcttggggaagacatcaaggcactac
ttgaacattcgctacactttgcttccctacctctataccctattttacaaagctcatata
caaggaggcatggttgtaaggccacttcttcatgagttctatgcagatgaagcagtgtgg
actattgataggcagttcatattgggctctggactacttatcggtatcactcctgtactg
gacccaggcatagaaaaagtgactgcatatattcctgatgcagtgtggtatgattatgaa
acagatggaagaacattgtggagaaaacaactgattgagatgtatatcctggcagacaaa
ctagaacttcatgcctgccatggctcaggttctgtgggaaataaaaatgatattttctac
cagttttctgtttcaaataatagtttgcaaataaatattttgcacaggaagtacactgat
ccaaacaatttaaaatttgaggaaattaaaatctgtggattagctcttgaattaacagtg
cttactgtgtctcaaaatggagtagtgcaaaattctgcttagacgatcagctataattct
tccaataaggttgcccatataacagggcttgagcttgaattaggaaaatcttatttacta
tcttggactcaaatgctcagtgacagtgaaagatttagctgtcatcctgctgccaatgca
acagcaaaaaaatgcagagctattggctgcatctggaataaacaaatttctgtaccaaat
gttcccttctgttactgccttcccaaccttcgctattctgtcaatcaaattcagcataca
tcttcaggtttaacagcaaacctcagcacaaatgttaagtatgttagctgttctcagtct
cctactataccaattgatatacttttcttggaagtgaaatatcattatgacactatgctg
caatttaagatttatgattataacagtaaaaggtatgaggttccgatattgttaaatatc
cctaacagttctagaagtacagctgtgagttgattctatgaagcatcagttcgaaatgaa
ccatttgggatccaagttcgatgcaaaagcacagggacggttatttgggatactcaggta
cctggtttcatttctagtgacatgttcattcagatttctactcacctcccatcactgtat
gtatatggatttggtaaaactgaacacactatgtttcagccttatatgaagtggaacacc
tggaaaatgtacacaagactaactcctgctggttacaaagtgaattcttatggtttctac
cccttcttcatggccttggaaaatgatggaaatgcttatggaattcttttacttaacagt
aatacaatggtaatataccagccaactcctggtctgacatattgcacaattggaggaatt
gtagacttttacatggttttgggccccactccagagtttacttttcaagaatacactgca
ttgattggatgaccactcatgtcaccttattgggctttgggattccagctatgccattat
gcatacagaaatgagncctctgatctgtatatggaaatcaaagcagctcagattccctat
gatgtacaatacacggatattgattatatggaaagtccattagacttcatgcttagtcca
cacttctctggattgccaaaatttgttgacaaaataaaaacaaaaggaatgagattcatc
atcattattaatccaaccatttcttgcaatgaaaccaactatccagcatttgcaaaagga
ttaaaggatgatgtctttatcaagtggcctgataacagtgatattgtatggggaaatgtc
tggctaggttatcctaatgtaactgttgatgactcaataacatgggaaaataatcaaaca
cacgtggaggtaagcttgtatgccattggtattatgataatttttaatttgccaccaaca
ccaagcagcaaagatttggaaacacagtcatttggtctgagtttcaaaaccacatgcatg
gaagggcaatagttcctgccagatggatgcccagttagacattatgatgtacataatctc
tatggatggtcacaggctaaacctacctataatgctttacagaagatcacaagtgagcgt
ggaattgtcattacccgttcaacatattcatctagtggaagatggtctgggcactggctt
ggtgataatagttcagcttgggatcaactttataaatctgttattggtatgatggagttt
agcttttttggactatcctatactggaacagatatctgtggcttcttcaaagctgcagag
tatgaaatgtgtgaccgctggatggagctgggggcattttatccatattctagaaatcac
aatatcaaaggaacaaggaggcaagatcctgttgccttggatgacagatttcaaaacatt
tccaggaatatactcaatagaagatacacattgtcaccttatctctacacattaatgtat
gaagcccatgtccatggtatcactgtagttcgtcctgtactccatgagtttgtggaagac
aaaacaacatggaatgtgtacaaacaatttttgtggggaccagcactactcagccctata
ttgaatgctacatcagtatgaccttatatactcaatgcacgctggtatgattttacacag
taa

DBGET integrated database retrieval system