KEGG   Alligator sinensis (Chinese alligator): 102370737Help
Entry
102370737         CDS       T02922                                 

Definition
(RefSeq) cationic trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102370737
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:asn01002]
    102370737
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asn04147]
    102370737
Enzymes [BR:asn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     102370737
Peptidases [BR:asn01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   102370737
Exosome [BR:asn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102370737
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2
Motif
Other DBs
NCBI-GeneID: 102370737
NCBI-ProteinID: XP_006031387
UniProt: A0A1U7SJ17
LinkDB All DBs
Position
Unknown
AA seq 247 aa AA seqDB search
MKFLLILACLGATVAFPVDDDDDKIVGGYACPKGSVPYQASLNAGYHFCGGALINRQWVV
SAAHCYKSRIQVRLGEYNIDREDRTEQFINSAKVIRHRKYNPQTIDNDIMLIKLATPATL
NSYVSTIPLPTACPAVGTTCLISGWGNTLSSGTNYPEILQCLKAPVLSDTQCKNAYPGQI
TSSMICIGFLEGGKDSCQGDSGGPVVCNGQLQGIVSWGKGCALKGYPGVYTKVCNFTTWI
KDTIASN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctcctgattctcgcctgcctgggagcaacagttgctttccctgttgacgat
gatgacgacaagatcgttggaggctatgcctgtcctaagggttctgtgccctaccaggcc
tctctgaacgctgggtaccacttctgtgggggtgctctcatcaacagacaatgggttgtg
tcagctgctcactgctacaaatcccgcatccaggtgaggctgggagagtacaacatcgac
cgggaggataggactgaacaattcatcaattccgcaaaagtcattcgacaccggaaatac
aacccacagaccatagataatgacatcatgctgatcaaactggcaaccccagcaaccttg
aactcttatgtctcaaccatcccacttcccacagcctgtccagctgttgggacgacgtgt
ttaatttctgggtggggaaacaccctcagcagtggcactaattaccctgagatactccag
tgtctgaaagctccagtcctgtctgacacccagtgcaaaaatgcttacccaggacaaatc
accagcagcatgatatgcataggattcttggaaggtggcaaagactcctgtcagggcgat
tctggtggtccagtcgtgtgtaacgggcagctccaggggatcgtttcctggggaaaaggc
tgtgccctgaagggttaccctggtgtctacaccaaggtctgcaattttactacctggatc
aaggacaccattgccagtaactga

DBGET integrated database retrieval system