KEGG   Alligator sinensis (Chinese alligator): 102371199Help
Entry
102371199         CDS       T02922                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:asn01001]
    102371199 (RET)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102371199 (RET)
Protein kinases [BR:asn01001]
 Receptor tyrosine kinases (RTK)
  RET family
   102371199 (RET)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr RET_CLD1 RET_CLD3 Pkinase RET_CLD4 Cadherin RIO1 Pkinase_fungal Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 102371199
NCBI-ProteinID: XP_006018550
UniProt: A0A1U7R7D4
LinkDB All DBs
Position
Unknown
AA seq 1113 aa AA seqDB search
MTVACTATLQKPQGTVSKGRERDKAVSLGLYFPRREYSENVYIDQPAGTPLLHIHALQDF
HGEEVHFQLCQRILIHRIGTHENQWFQIKEKTGLLYLNKSLDRGDFDILSGGNWVSLPKA
VLQVSLSSHPFQGKKCESPTYAVVSLFIINATAPPCSSRIARQLCFTEMDLSFHIKENKP
PGMFHQLQLPQVQHMCQNLSISYKLLAAEGLPFRYNESTTGVSVVQRLDREEREKYELIA
KCTVREGSKEMQVEVPFLVNVLDEDDSPPFLFNGTSTADAIVKFNRKEGTAVAALTVCDA
DTTPIYPLESSRKKYTGTIITADPWINETFRVEHLFHEIRFSPNGSQVRGTLHEYKLVLD
KNISVSENRSFQLDVLVNDTEFNGPERSLMLHFNVSILPVSIQFPNMTYQFTVNRNAERF
AQIGKVCIENCMKFCGVNITYRLLPPNVSCYAVGILQAREEKYGSLYVNDSSVLQRPECK
EIQYPVIAMDKQSKKHAKTQLTIVLEGTLLEREEECPDSCAVSKHRIECEECGGLGVLTG
KCKWRQGSGEGITSNYSTCTPSIKTCPDGTCDVIESKDPAVCPQDCTSGIIVGGHERGIL
GIKSGYGVCYCFPRENCYCEKDYITETLCDDVCKTVIAGAVLLSFIISVLLSSYFIHRYH
KNTPKPPIASAEMTFRRPAQSYPISYSSTNVRRPSLDSMENQVSVDTFKIPEDPKWEFPR
KNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASQSELRDLLSEFNLLKQ
VNHPHVIKLYGACSQDGPLYLIVEYAKYGSLRSFLRESRKVGPSYVGSDGNRNSSYLDNP
DERALTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYE
EDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGNPYPGIAPERLF
NLLKTGYRMERPENCSEEMYNLMLRCWKQEPDKRPTFAEISKELEKMMVKSRDYLDLAAS
TPSDSLLYDDGLSEEETPLVDCNNAPLPRTLPSTWIENKLYGMSYPNWPEESPVPLTRFD
GTNSVFSRYANDSVYANWMVSPSAAKFMDKFDS
NT seq 3342 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtagcttgtactgcaactctccagaaacctcaggggactgtgagcaaaggaaga
gaaagggacaaagcagtttccttgggtctttacttccccaggagagaatactctgaaaat
gtctacatagatcagcctgcagggacaccgctactgcacatccatgccttgcaggatttt
catggggaggaggtgcactttcagctgtgtcagcgtatccttattcatcgaattgggaca
catgaaaatcagtggtttcaaatcaaagaaaaaacagggcttctctacctcaataaaagt
ctggatagaggagacttcgatatcctgtctggaggaaactgggtttcattaccaaaggca
gttcttcaggtctctctttcatcccatcccttccaagggaaaaaatgtgaatctcccact
tacgctgtggtttctctcttcatcatcaatgccactgcaccaccttgcagttctcggata
gcaaggcagctctgcttcacagaaatggacctctcctttcacatcaaagagaataaacca
cccggcatgtttcatcagcttcagttaccccaagtacagcatatgtgtcagaacctcagc
atttcctacaaattgctagcagctgaagggctgccatttcgctacaatgagtctaccaca
ggggtgagtgtggtacaacggttggatcgggaagaaagagagaagtatgagttgattgcc
aaatgtacagtgagagaaggttccaaggagatgcaggttgaggtgccttttctggtgaat
gtattagatgaagacgactctccccccttccttttcaatggcactagcacggcagatgct
attgtgaaattcaacagaaaagagggaacggctgtagcagcactgacagtatgtgatgca
gacactacacctatttaccctcttgaaagcagcaggaagaagtacacaggaaccatcatt
acagctgatccctggataaatgaaacatttcgtgtggagcacctcttccatgaaatccgt
ttcagcccaaatggtagccaagtgaggggaactctgcatgaatacaaactggtactggat
aaaaatatttcagtctcagagaaccgttccttccagttggatgttctggtgaatgacaca
gagtttaatggccctgaaagatcactgatgctccacttcaatgtttccattcttcctgtc
agcattcagtttcctaacatgacataccagttcacagttaacagaaatgctgaacgtttt
gcacagattggaaaagtctgcatcgaaaactgtatgaagttctgtggagtaaacattacc
tacagattgctgccccccaatgttagctgctatgctgtgggaatacttcaggcccgagaa
gagaaatatggaagcctgtatgtgaatgattcttctgtgctgcagagacctgaatgcaaa
gaaatacaataccctgttatagcaatggacaagcagagcaagaaacatgccaaaactcag
ctcactattgtgttggaaggaacacttcttgagagagaggaggagtgcccagactcttgt
gctgtgagtaagcaccgcattgaatgtgaagaatgtggtggcttaggagtgctaacaggg
aaatgcaagtggagacagggaagtggagaaggaatcacgtccaattattctacctgcact
ccaagcatcaagacttgtccagatggcacctgtgatgttattgagagcaaggatcctgcc
gtgtgccctcaagactgcacaagtgggatcatcgttggtggccatgagagaggcattctt
ggaattaagtcaggatatggggtttgttattgctttccaagggaaaactgttactgtgag
aaagattatattactgagacgctgtgtgatgatgtgtgcaagactgtgatagcaggtgca
gttctgctgtccttcattatctcagtgttgctctcttcttatttcattcaccgttaccac
aagaatactccaaagccacctattgcctcagcagaaatgacttttcggcgccctgctcag
tcctaccccatcagttattcttccactaatgtccgccgaccatcactggactcaatggaa
aaccaggtgtcagtagacacctttaaaataccagaggacccaaaatgggaatttcctcgg
aagaacctggttcttggcaagactctaggagaaggagaatttggaaaggtagtcaaggca
acagcattcagactcaaagggaaagcaggctataccactgtggcagtgaaaatgctaaaa
gaaaatgcttcccagagtgagctgagagatctcctttcagagttcaatctcttaaaacag
gttaaccaccctcacgtcatcaaactttatggggcttgcagtcaagatggaccactgtat
ttaattgtggaatatgcaaagtatggctcgttacgcagttttctcagggaaagtcggaaa
gtgggacctagctacgtaggcagcgatggcaacagaaattcaagctacttggacaaccca
gatgagagagccttaacaatgggagacctcatctcatttgcatggcagatatctcgagga
atgcagtaccttgcagaaatgaagcttgttcatcgggatttagcagccagaaatgtgctg
gtcgcagaaggacgcaaaatgaagatttctgattttggcttatctcgagatgtttatgaa
gaggattcttatgtcaaaagaagcaagggtcggatacctgtcaaatggatggcaatagaa
tctctgtttgatcatatctatacaacacaaagcgatgtatggtcatttggagttctgctc
tgggagattgtaaccctgggaggtaatccctatccaggtattgctcccgaaagactcttt
aacctcctaaaaacaggctatagaatggagagaccagaaaactgcagtgaagaaatgtat
aatctgatgttgcgctgctggaaacaggaaccagataagaggccaacatttgctgagatc
agcaaggaattggagaaaatgatggtgaagagtagggactacttagatcttgcagcttcc
acaccctctgactccttactttatgatgacgggctctcagaagaggagactcccctcgtg
gactgtaataatgctcccctccctcgaacccttccttccacatggattgaaaacaaactc
tatggcatgtcatacccgaactggcctgaggagagccccgttccactcacaagattcgat
ggcactaactctgtgttttcaagatatgcaaatgatagtgtttatgctaactggatggtt
tcaccctcagcggcaaaatttatggacaagtttgatagttaa

DBGET integrated database retrieval system