KEGG   Alligator sinensis (Chinese alligator): 102371526Help
Entry
102371526         CDS       T02922                                 

Gene name
THPO
Definition
(RefSeq) thrombopoietin isoform X2
  KO
K06854  thrombopoietin
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102371526 (THPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:asn04052]
    102371526 (THPO)
Cytokines and growth factors [BR:asn04052]
 Cytokines
  CSF and other factors
   102371526 (THPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EPO_TPO
Motif
Other DBs
NCBI-GeneID: 102371526
NCBI-ProteinID: XP_006017229
UniProt: A0A1U7R4N6
LinkDB All DBs
Position
Unknown
AA seq 194 aa AA seqDB search
MELNRLLLLTAFLLHVRLSRMSPTRLVCDSRLIHKYIAEAKDMERRAGLCQELLPLPKPV
LLPLVDFSLREWKVKTNETKRQEILCDLAMLVDAVTAAQSHAGLECAGVLLEQLYHKTSS
FHLLLQTFSWQVSTGSPSCAPRTVAQSHPSTTFLAYRQLVQGKLRFLFHDLARESCAEGS
PGKAPGPPSPSAGR
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggagctgaaccgcctgctgctcctcacagccttcctcctgcatgtccggctgtccagg
atgagcccgacccgcctggtctgcgacagccgccttatccacaagtacattgctgaggcc
aaggacatggagaggagagcgggcctgtgccaggagctgctcccgctccccaagcccgtc
ctgctgcccctggtggacttcagcctccgcgagtggaaagtcaagaccaatgagaccaag
cggcaggagatcctctgtgacctggcgatgctggtagatgctgtgacggccgcacagagc
cacgcggggctggagtgtgcaggtgtcctgctagagcagctctaccacaaaaccagctcc
ttccacctgctgctgcagactttcagctggcaggtgagcactggaagccccagctgcgca
ccacggaccgtggcccagagccaccccagcaccacattcctagcataccggcagctggtg
cagggcaagctgaggttcctgttccacgacctggcccgggagtcatgtgctgagggcagc
cctggcaaagccccaggaccccccagcccctcagcgggccggtga

DBGET integrated database retrieval system