KEGG   Alligator sinensis (Chinese alligator): 102371766Help
Entry
102371766         CDS       T02922                                 

Gene name
HSD17B4
Definition
(RefSeq) peroxisomal multifunctional enzyme type 2
  KO
K12405  (3R)-3-hydroxyacyl-CoA dehydrogenase / 3a,7a,12a-trihydroxy-5b-cholest-24-enoyl-CoA hydratase / enoyl-CoA hydratase 2 [EC:1.1.1.- 4.2.1.107 4.2.1.119]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00120  Primary bile acid biosynthesis
asn01040  Biosynthesis of unsaturated fatty acids
asn01100  Metabolic pathways
asn01212  Fatty acid metabolism
asn04146  Peroxisome
Module
asn_M00861  beta-Oxidation, peroxisome, VLCFA
asn_M00862  beta-Oxidation, peroxisome, tri/dihydroxycholestanoyl-CoA => choloyl/chenodeoxycholoyl-CoA
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    102371766 (HSD17B4)
   01040 Biosynthesis of unsaturated fatty acids
    102371766 (HSD17B4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102371766 (HSD17B4)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     102371766 (HSD17B4)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.107  3alpha,7alpha,12alpha-trihydroxy-5beta-cholest-24-enoyl-CoA hydratase
     102371766 (HSD17B4)
    4.2.1.119  enoyl-CoA hydratase 2
     102371766 (HSD17B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short MaoC_dehydratas adh_short_C2 SCP2 KR MaoC_dehydrat_N Alkyl_sulf_C
Motif
Other DBs
NCBI-GeneID: 102371766
NCBI-ProteinID: XP_006034004
UniProt: A0A1U7SLG1
LinkDB All DBs
Position
Unknown
AA seq 739 aa AA seqDB search
MSARLRFDGRVVLVTGGGGGLGRAYALAFAERGASVVVNDLGGDFKGHGKSSSAADKVVE
EIRAKGGKAVANYDSVEAGEKLVKKALEAFGRIDIVINNAGILRDRSFARISDEDWDIIH
RVHLKGSFLVTRAAWNHMKNQKFGRIIMTSSAAGIYGNFGQANYSAAKLGLLGLANTLAV
EGRKYNIHCNTIAPTAGSRMTQTIMPPDMLDAFKPEYVSPLVLWLCHESCQENGSLFEVG
AGWIGKLRWERAQGAIVREKTLPMTPEAVQDKWGKICDFDNASKPRTIQESVSLLNDVLS
QIESEEGVSVNSTSSTGSVAIPSIDHTKYVGYKLPPLMYKYTHLEPILYALGVGMSTKDP
DHLKFLFEGNEEFCCLPSFGVIPAQASMLDGGLTSVPGLNIDFTKLLHGEQYLEVYKPFP
TSGELTSEMTIADFLDKGSGAVILLDVYTYCGKDLLCYNQFSLFVVGAGGFGGKQTSEKA
KVTVNPPNRPPDAVFSDVTTVDQAALYRLSGDWNPLHIDPSFAALGGFQKPILHGLCSFG
FATRHVLKHFANNDVTKFKAVKVRFAKPVIPGQTLQTEMWKEGNRIHFQSKVKETGQVAI
SGAYVDLISAFDKPSTQKAMKAAELQSDLVFEEIRRRIKEVGNQLVKKVNAVFQWDITKG
GKTAVQWTIDLKNGSGTVYQGPAQGSADTIFTLSDEDFMEVVKGNLNPQKAFFSGKLRLK
GNIMLSQKLEMILKDYAKL
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcccggctgcgctttgacgggcgtgtcgtgctggtgaccggcgggggcggagga
ctagggagagcctatgctctggcttttgctgaaagaggagcttctgtagtggtgaatgat
ctgggaggtgacttcaaaggacatggcaaaagctcctcagctgctgacaaagtagttgaa
gaaataagagcaaaaggagggaaagcagtagcaaactacgattcagtggaagctggagag
aagcttgtgaagaaagcactagaagcttttgggagaatagatattgttataaacaatgca
gggattctgagagaccgttcatttgctagaataagtgatgaagattgggatataattcac
agagttcacttgaagggatcattcctggtcactcgagctgcatggaatcatatgaaaaat
cagaagtttggcagaataattatgacatcttcagctgctggaatttatggcaactttggt
caggcgaactacagtgctgccaaacttggccttctgggtcttgcaaatacgcttgcagtt
gaaggcagaaaatacaacattcactgtaacacaattgcacctactgctggctcaaggatg
actcagacaattatgccaccagatatgttggatgctttcaaaccagagtacgtctctcct
ttagtcctgtggctttgccatgagagctgtcaggagaatggaagcctgtttgaggtagga
gctggatggattgggaaattacgctgggagcgagctcagggtgccatcgtccgagagaag
actcttccaatgactccagaggctgtacaagataaatgggggaagatctgtgactttgat
aatgccagcaagccccggaccatccaagaatcagtaagcttactgaatgatgttctgagt
caaatagagtctgaagaaggagtgtcagtgaattccacaagctccactggatctgtggcc
attccaagcattgaccataccaaatatgttggctacaagttgcctcctttgatgtataag
tatactcacttggaacctattttgtatgctcttggtgtgggaatgtcaaccaaggatcca
gatcatctcaagtttctgtttgaggggaatgaagagttttgctgcttacccagctttgga
gttatcccagcgcaggcttctatgttggatggtggactgacttctgttccaggacttaat
attgattttacaaagcttctacatggtgagcaatatctggaggtgtataaaccttttcca
acctcaggagagttaacttcagaaatgactattgctgattttcttgacaaaggctcagga
gctgtcattctgttagatgtttatacctactgtggaaaggatctattgtgctataaccag
ttctcgttgtttgttgttggagctggaggttttgggggaaaacaaacatctgaaaaggcc
aaggtaactgtgaacccacctaaccgaccacctgatgctgttttttctgatgtcacaaca
gttgatcaggctgctttgtatcgactcagtggggactggaatcctttacacattgaccca
agttttgctgctcttggaggatttcagaagcccatattgcatggactgtgttcttttggg
tttgctaccagacatgttttgaagcactttgcaaataatgatgtcactaaattcaaggcg
gttaaggtccgttttgcaaaaccagtcattccaggacaaactcttcagacagagatgtgg
aaggagggaaacagaattcactttcagagcaaggtgaaagaaactggacaagttgccatt
tcaggagcatatgtggatctaatatcagcctttgataaaccttcaactcagaaagccatg
aaggctgcagagttgcagagtgaccttgtgtttgaagaaattagacgtcgcatcaaagag
gttggaaatcaactggtaaagaaagtaaatgctgtatttcagtgggacatcactaaaggt
ggaaagactgcagtgcagtggactattgacttgaaaaatggttctggaacagtatatcaa
ggccctgcacagggttctgctgataccatctttactctctctgatgaagacttcatggag
gtggtcaaaggcaatttaaatccacaaaaggcattcttttctggtaaactcagactgaaa
ggtaatattatgctgagccagaagctggagatgattctcaaagattatgccaaactctga

DBGET integrated database retrieval system