KEGG   Alligator sinensis (Chinese alligator): 102371879
Entry
102371879         CDS       T02922                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: TGF-beta receptor type-2-like
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn04010  MAPK signaling pathway
asn04060  Cytokine-cytokine receptor interaction
asn04068  FoxO signaling pathway
asn04144  Endocytosis
asn04218  Cellular senescence
asn04350  TGF-beta signaling pathway
asn04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:asn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102371879
   04350 TGF-beta signaling pathway
    102371879
   04068 FoxO signaling pathway
    102371879
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102371879
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102371879
  09143 Cell growth and death
   04218 Cellular senescence
    102371879
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102371879
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:asn01001]
    102371879
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     102371879
Protein kinases [BR:asn01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   102371879
SSDB
Motif
Pfam: ecTbetaR2 Pkinase PK_Tyr_Ser-Thr Pkinase_fungal TNFR_16_TM
Other DBs
NCBI-GeneID: 102371879
NCBI-ProteinID: XP_014372511
UniProt: A0A1U8CWY2
LinkDB
Position
Unknown
AA seq 565 aa
MDYWKRLGLISLLLLSFSCYAWTRRNLKTNLCKWCDYTIPVCEDKVCYSNCNLNSYCENP
YEICVAIWRQDNESISISTLCHNPQLPIENIMVPNYNTSRCIMTHLPREDGAFYICGCVD
EQECNDKLIFENHTNGYSMQQSEEVIPVAAISLLPPLLVAVMITVIFYLCRTQKQRKRAK
DWSQKHTQHRALPESGKAAEHDEKLSVMIDDNHSHMSSTCANSINHNTELLPIELDEMVG
KGQFAEVWRAKLNHASSGQYETVAVKIFPCEEYSSWKNESQIFTDTSLKHESVLQFLTAE
DRGSGPRKEYWLITAYHSRGNLKDYLSRHILSWMDLQKMAGSLVNGVAHLHSDYTACGRP
KIPIAHRDIKSTNILVKNECECVLCDFGIALRLDPSLTADDFANSGQVGTARYMAPEVLE
SRVNLEDLESFKQMDVYSMALVLWEMASRCEVVGEVKSYELPFGSKVQEQPCVDTMRDIV
LHGRGRPEIPSNWLVHQGMHFLCDTITECWDHDPEARLTAHCXRFNLMAQMDCDDILNNN
MDNEAGKTVCPSSEHQASDENRNSQ
NT seq 1698 nt   +upstreamnt  +downstreamnt
atggattactggaagagactgggtctgatttccctactgctgctatccttctcatgttat
gcctggacacgaaggaatttgaagaccaacttgtgtaagtggtgcgactacacaatcccg
gtgtgcgaagacaaggtatgctacagcaactgcaatttgaactcctactgtgagaatcca
tatgaaatctgtgtggctatatggagacaagacaatgagagcatcagcatcagcactctc
tgccacaacccacagcttcccatagaaaacatcatggttcccaattacaacacctccagg
tgcatcatgacccacctgccaagggaagacggagcattctacatctgcggctgcgtggac
gaacaggaatgcaacgacaagctcatctttgaaaatcacaccaatggatattccatgcaa
cagagcgaggaggtcatccccgtggctgcaataagcctgctccctcctctgctagtggct
gtcatgataacagttatattttacctctgccgcacccaaaagcagagaaagagagccaag
gactggagccagaagcacacacaacaccgggccttgcccgagtcagggaaagctgccgag
cacgatgagaagttgtcggtgatgatagacgacaatcactcccacatgagctcaacctgc
gccaacagcatcaaccacaacactgagctgctccccatcgagttggacgagatggtgggg
aaaggccagtttgcagaggtctggagggccaagttgaatcatgccagctcagggcaatac
gagacagtggctgttaagattttcccttgcgaggaatattcttcctggaaaaatgagagc
cagattttcacagacaccagcctcaagcacgaaagtgtccttcagttcctcacggcagag
gacagagggtctggcccgcgcaaggagtactggctcatcactgcttaccatagtagaggg
aacctgaaggactacctgtcccggcacatactgagctggatggacttacaaaagatggca
ggctcccttgtgaacggtgtggctcatctacacagtgactacactgcgtgtggcaggcca
aagatccccattgcccaccgggatatcaaaagcaccaacatcctggttaagaacgaatgc
gaatgcgtgctctgcgattttggcatcgccctccgactcgacccttccttaacagcagat
gactttgccaacagtggacaggttggcactgccaggtacatggctccagaagttctagag
tccagagtgaatctagaagatttggagtccttcaaacaaatggatgtctactcgatggcc
ttggttttgtgggaaatggcctccaggtgcgaggtggtaggagaggtaaagagttacgag
ctgccttttgggtcaaaagtccaggagcaaccctgcgtggataccatgagagacattgtg
ctgcatggcaggggacgcccagaaatacctagcaactggctggtgcatcagggaatgcac
tttctgtgcgacaccatcacagagtgctgggatcacgaccccgaggctcggctcactgcc
cactgtngtaggttcaacttgatggcgcagatggactgcgatgacatcctcaacaacaac
atggacaacgaggctggcaaaacagtttgccccagcagcgaacaccaagccagtgacgag
aacagaaacagccagtga

DBGET integrated database retrieval system