KEGG   Alligator sinensis (Chinese alligator): 102372324Help
Entry
102372324         CDS       T02922                                 

Gene name
PFKM
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00010  Glycolysis / Gluconeogenesis
asn00030  Pentose phosphate pathway
asn00051  Fructose and mannose metabolism
asn00052  Galactose metabolism
asn01100  Metabolic pathways
asn01200  Carbon metabolism
asn01230  Biosynthesis of amino acids
asn03018  RNA degradation
Module
asn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102372324 (PFKM)
   00030 Pentose phosphate pathway
    102372324 (PFKM)
   00051 Fructose and mannose metabolism
    102372324 (PFKM)
   00052 Galactose metabolism
    102372324 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102372324 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:asn01009]
    102372324 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:asn03019]
    102372324 (PFKM)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102372324 (PFKM)
Protein phosphatases and associated proteins [BR:asn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102372324 (PFKM)
Messenger RNA biogenesis [BR:asn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102372324 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Tmemb_40
Motif
Other DBs
NCBI-GeneID: 102372324
NCBI-ProteinID: XP_006030654
UniProt: A0A1U7S3S6
LinkDB All DBs
Position
Unknown
AA seq 827 aa AA seqDB search
MWAPLNFTLLWSKLFLSASLAFAAVFFFLTFFPFSQKRKELPAKKKMQPQERNEHTYSLG
TGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVYFVHEGYQGLVDGGNNIKEATWESV
SMMLQLGGTVIGSARCQDFRTREGRLKAARNLVKRGVTNLCVIGGDGSLTGADTFRAEWS
GLLADLVKTGGITADEAKKSGFLNIVGMVGSIDNDFCGTDMTIGTDSALHRIMEIVDAIT
TTAQSHQRTFVLEVMGRHCGYLALVTSLACGADWVFIPESPPEDDWEEHLCRRLTETRGR
GSRLNIIIVAEGAIDKHGKAITSEDIKSLVVKRLGYDTRVTILGHVQRGGTPSAFDRILG
SRMGVEAVMALLEGTPDSPACVVSLSGNQAVRLPLMECVQVTKDVTTAMKEGRFDDAVKL
RGRSFQNNWNVYKLLAHVRPPSTKSGYNLAVLNVGAPAAGMNAAVRSTVRIGIIHGHRML
AVYDGFEGLAEGKVEEIGWAGVGGWTGLGGSKLGTKRTLPKKYFEQISATISDFSIHGLI
IIGGFEAFTGSLEMIDGRAKFEELCIPICVIPATVSNNVPGSDFSIGADTALNTITMTCD
RIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIYEDPFTIRDLQINVEHLTE
KMKTTVKRGLVLRNEKCNDNYTTDFIFNLYSEEGKGIFDCRKNVLGHMQQGGTPTPFDRN
FGTKMGTKAVAWITGKIKECSRHGRIFANTADSACLLGMRRRSLVFQPLAELKEQTDFDH
RLPKEQWWLKLRPILKILAKYKIDLDTSEKAHLEHITRKRVSMESNI
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgtgggctcccctgaacttcacactcctttggtccaaactcttcctttctgcatcgctt
gcttttgccgccgttttctttttcctcaccttctttcccttttcccagaaaaggaaggag
ctgccagctaagaaaaagatgcagccacaagaaagaaatgagcacacgtacagcctgggg
accgggaaggccatcgccgtgctgacctcgggaggagatgcccagggcatgaatgcagct
gtccgggccgtggtccgagtgggcatctacacaggcgccaaggtctactttgttcatgag
ggttaccaggggctggtcgatggaggtaacaacatcaaggaggccacatgggagagcgtg
tcaatgatgctgcagctgggtggcaccgtgatcgggagtgcccggtgccaggatttccgc
acacgcgaaggccgcctcaaagctgctcgcaacctggtgaagagaggcgtcaccaacctg
tgcgtcatcggtggcgacggcagcctcactggagctgacaccttccgggccgagtggagc
ggcttgctggcagacttggtgaagacaggtggcatcacggcggacgaggcgaagaagtcc
ggtttcctaaacattgtgggcatggtcgggtccatcgacaatgacttctgcggcactgat
atgaccatcggcactgactctgccctgcaccgcatcatggagatcgtggatgccatcact
accacagctcagagccaccagcggacattcgtgctagaagtgatgggccggcactgcggc
tacctggctctggtgacctctctggcctgcggcgctgactgggtgttcatccctgagtct
ccccctgaggatgactgggaggaacacttgtgcaggaggctcactgagaccagaggccgg
ggatcacggctgaacatcattattgtggctgaaggtgccatcgacaagcatgggaaggcc
atcacttcagaggacatcaagagtctggtggtgaagcgcctgggctacgacacgagagtc
accatcctcgggcacgtgcagcgtggcgggacaccctccgccttcgaccgcatcctgggg
agccggatgggggtagaagctgtcatggccttgctggaggggactcccgacagcccagcg
tgcgttgtcagcctgtccggcaaccaggctgtccgcctgccgctcatggagtgcgtccag
gtgaccaaagacgtcacgaccgcgatgaaagagggccggttcgatgatgccgtcaagctg
aggggaaggagtttccagaacaactggaacgtgtacaagctgctggcccatgtgcgccca
ccctccaccaagagcggttataacttggctgtgctgaatgtcggtgccccagctgctggc
atgaatgcggctgtgagatcgaccgtcaggattgggatcatccacgggcacaggatgctg
gcggtgtatgacgggttcgaggggctcgcggaaggaaaggtggaggagatcggatgggca
ggcgtcggcggctggactgggctgggcggatcaaagctagggacaaaaaggaccctgcct
aagaaatactttgagcagatcagtgcaaccatcagtgatttcagcatccatgggctgatc
atcatcgggggctttgaggctttcaccgggagcctggagatgatcgatggccgggccaag
ttcgaggagctgtgcatccctatctgtgtgattccagccactgtgtccaacaacgtccct
ggctccgacttcagtattggtgcggacactgccctcaacaccattaccatgacctgtgat
cggatcaagcaatctgcagccggcaccaagcggcgggtctttatcatcgagaccatggga
ggttactgtggctacctggccaccatggctggcctggccgctggcgctgatgcagcttat
atctatgaagatcccttcactatccgggacttgcagatcaacgtggagcacttgactgag
aagatgaagaccacggtcaagagaggcctggtgttgaggaacgagaagtgcaacgacaac
tacaccacggatttcatcttcaacttgtactcggaggaaggcaagggcatctttgactgc
aggaagaatgtgctgggacacatgcagcagggcgggaccccaacaccctttgacaggaac
tttggcactaaaatgggcacgaaggccgtggcctggatcactgggaagatcaaggagtgc
tcccggcatgggcgcatctttgcaaacaccgcggattcagcctgtctcctgggcatgcgc
cgacggagccttgtcttccagccgctcgctgaactcaaagagcagacagactttgaccat
cgcctccccaaagagcagtggtggctcaagcttcgtcccatcttgaagatcctggccaaa
tacaagattgacttggatacctcagagaaagctcacttggaacacatcacgcgcaagaga
gtatccatggagtccaacatctaa

DBGET integrated database retrieval system