KEGG   Alligator sinensis (Chinese alligator): 102372390Help
Entry
102372390         CDS       T02922                                 

Gene name
MBD4
Definition
(RefSeq) methyl-CpG-binding domain protein 4 isoform X1
  KO
K10801  methyl-CpG-binding domain protein 4 [EC:3.2.2.-]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:asn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    102372390 (MBD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:asn03036]
    102372390 (MBD4)
   03400 DNA repair and recombination proteins [BR:asn03400]
    102372390 (MBD4)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     102372390 (MBD4)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic type
  Heterochromatin formation proteins
   MBPs (metylated DNA binding proteins)
    102372390 (MBD4)
DNA repair and recombination proteins [BR:asn03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     102372390 (MBD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MBD HhH-GPD
Motif
Other DBs
NCBI-GeneID: 102372390
NCBI-ProteinID: XP_006024196
UniProt: A0A1U7S4E0
LinkDB All DBs
Position
Unknown
AA seq 565 aa AA seqDB search
MAASEVGEQGKGSDQSDMQTKDEGNQLVTETEEHFDSQTEGTETIAENSLLCKEDAAVVS
EVVVACHKVAPNGWEKITKQRQSGKTAGKYDVYFISPEGVKLRSKRALVEYFHKTGETGL
KLEDFDFTTPAQSNTKVRDKKCSAKAVKTAIQKKEHDNTKQEFSAQNGKGGGSVQVLQTI
DEEQENISVTFTQGTEDLVVKECKPKDDSLEVKENGIIEKRVQIKKARKRSEKKNPACTQ
NKRQRKIPCNKQEVEINKSKAFQRENNACASDSGDQNSDDVDTGKCGGDSGNALTSGSQS
EVNLGAVLAHSEEASGTTVELACSERSSDDTATKDSEENSAESEFGQGKDEMLLQSQDFK
SNAQTEISSSQPCGKKSLTSVKLLKEDYGPRTQVDRRKTSPYFSSKYNKEAPSPPRRKAL
RKWTPPRSPFNLVQEILFHDPWKLLIATIFLNKTSGKMAIPALWEFLEKYPSPEVTRTAD
WKEVSELLKPLGLYELRAKAIIKFSDEYLSKQWKYPIELHGIGKYGNDSYRIFCVNEWKE
VRPQDHKLNIYHAWLWENYEKLSLD
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcggaagtaggggagcaaggaaagggcagtgaccaaagtgacatgcaaaca
aaagatgaaggaaaccagttagtgacagagacagaagaacattttgattcacaaactgaa
ggtactgagaccatagcagagaacagtctcctgtgtaaagaagatgcagctgttgtctct
gaagtggttgttgcatgtcacaaagtcgctccaaatggatgggagaagatcacaaagcaa
agacaatcaggcaaaactgcaggaaaatatgatgtttattttatcagtcctgaaggagtg
aagttaagatccaaacgtgcacttgtagagtattttcataaaactggagaaaccggtctt
aaactagaagattttgattttactactcctgctcaaagtaataccaaggtgagagacaaa
aaatgcagtgcaaaagctgtgaaaaccgcaatacagaaaaaggaacatgacaatacaaaa
caagagtttagtgcacaaaatggtaaaggcggtggtagtgttcaggtacttcagactatt
gatgaagagcaggaaaacatttctgtcacgttcacccagggaacagaagacttggtcgtt
aaagaatgtaaaccaaaggatgattctttggaggttaaagaaaatgggataattgaaaaa
agagttcaaattaagaaagctagaaaaaggtcagaaaaaaagaatccagcttgtacccag
aacaaaagacagagaaaaataccgtgtaataaacaagaagttgaaataaataaaagcaaa
gcattccagagagagaataatgcttgtgcttctgatagtggtgatcagaactcagatgat
gtggatacaggaaagtgtgggggagactcaggaaacgcattgacatcgggctcccaatca
gaggtgaatcttggagcagtcttagctcactcagaagaggcatcaggaaccacagtggag
ttagcctgctcagagaggagttctgatgatacagctacaaaagactctgaggagaactct
gcagaatcagaatttgggcaggggaaggatgaaatgcttttgcagagccaggacttcaaa
tctaatgctcaaacagaaatcagcagttcacagccttgtggcaagaaaagtttgacatca
gttaagttgctgaaagaagattatggcccaagaacacaggtggacagaaggaaaaccagc
ccatatttttccagtaaatacaataaagaagctccaagcccacctaggcggaaggccttg
agaaaatggactcctcctcggtctccttttaatttggtccaagaaatactctttcatgat
ccctggaaactcctcattgcaaccatatttctcaacaaaacttcaggtaaaatggcaatc
cctgcactctgggagtttctggagaaatacccttctcctgaagtcacaagaacagctgac
tggaaggaagtgtcagagttgcttaaacctcttggcctctatgaactgagagcgaaggcc
attatcaagttttcagatgagtatctgagcaagcaatggaagtaccctattgaactgcat
ggaattggaaaatatggaaatgattcctacagaatcttttgtgttaatgagtggaaggag
gtacgcccacaagatcacaaactaaatatatatcatgcctggctctgggaaaattatgaa
aaactgagtcttgattga

DBGET integrated database retrieval system