KEGG   Alligator sinensis (Chinese alligator): 102372557Help
Entry
102372557         CDS       T02922                                 

Gene name
PFKP
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, platelet type isoform X5
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00010  Glycolysis / Gluconeogenesis
asn00030  Pentose phosphate pathway
asn00051  Fructose and mannose metabolism
asn00052  Galactose metabolism
asn01100  Metabolic pathways
asn01200  Carbon metabolism
asn01230  Biosynthesis of amino acids
asn03018  RNA degradation
Module
asn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102372557 (PFKP)
   00030 Pentose phosphate pathway
    102372557 (PFKP)
   00051 Fructose and mannose metabolism
    102372557 (PFKP)
   00052 Galactose metabolism
    102372557 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102372557 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:asn01009]
    102372557 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:asn03019]
    102372557 (PFKP)
Enzymes [BR:asn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102372557 (PFKP)
Protein phosphatases and associated proteins [BR:asn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102372557 (PFKP)
Messenger RNA biogenesis [BR:asn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102372557 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102372557
NCBI-ProteinID: XP_006024122
UniProt: A0A1U7RUE2
LinkDB All DBs
Position
Unknown
AA seq 789 aa AA seqDB search
MEPHPADKKLFENLSGSGKAIGVLTSGGDAEGMNAAVRAVVRMGIYVEAKVYFVYEGYQG
MVDGGDNIVEVSWESVSSILQVGGTVIGSARCKAFRTREGRLQAAYNLVKRGITNLCVIG
GDGSLTGANLFREEWSGLLEELAESGKIDEEAVKKYAYLNIVGMVGSIDNDFCGTDMTIG
TDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVLIPEYPPEE
GWEDKMCVKLSENRARKKRLNIIIVAEGAIDSHNKAITSEQVKDLVVRCLGFDTRVTILG
HVQRGGTPSAFDRILASRMGVEAVLALLEATPDTPACVVSLSGNQAVRLPLMECVQMTQE
VQKAMDEARFKEAVQLRGRSFENNLKTYKLLSHRKQDAELPKSNFNVAVLNVGAPAAGMN
AAVRSAVRVGITEGHKMFAINDGFEGFAKGQIKTISWGDVGGWTGQGGSILGTKRTLPAK
YLEKIADQMRTYNINALMVIGGFEAYESCLQLYEARSRFEEFCIPICVLPATISNNVPGT
DFSIGADTALNAIVETCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIF
EEKFDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRK
NVLGHMQQGGAPSPFDRNFGTKISAKAIQWISKKLVETYRKEEGKVFANTDDTVCLLGMR
RRNLVFQPVAELKGETDFVHRIAKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMHR
PKEAETGAI
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcacccggccgacaagaagctgttcgagaacctgtcggggtcgggcaaggcc
atcggggtgctgaccagcggcggcgatgcggaaggtatgaatgcagcagtacgtgcagta
gtgcgcatgggaatctatgtagaagccaaagtgtattttgtgtatgagggttaccagggt
atggttgatggaggtgacaacattgttgaagtctcatgggaaagtgtatcaagtatcctg
caagtgggtggaacggttattgggagtgcacgctgcaaggcatttcgtacccgggaaggt
cgtttgcaagctgcttacaatcttgttaaacgtggaatcactaacctctgtgtgattggt
ggggatggaagcttaacaggtgctaatcttttccgtgaagaatggagtggacttttagag
gaactggcagaaagtggcaagattgacgaagaggcagttaagaaatatgcttacctcaac
attgtgggtatggttgggtccattgataatgatttctgtggtactgatatgaccatagga
actgactcagccttgcacagaatcattgaagttgtggatgcaattatgaccactgcccaa
agccatcagaggacctttgtactggaggttatgggaagacactgtgggtatctagccctt
gtgagtgccttagcttgtggtgcagattgggtactcattcctgaataccctccagaagaa
ggatgggaggataagatgtgtgttaagctgtctgagaaccgtgcacgaaagaaaagactg
aatattatcattgtagcagaaggtgccattgattctcacaacaaagccataacatcagag
caagttaaagatcttgtggttcggtgcctgggatttgacactcgtgtgactatactgggt
catgttcagagaggtggtacaccatcagcttttgatagaattttggcaagccgtatgggt
gtggaagctgtcctcgccctgcttgaagctacaccagatacccctgcttgtgttgtgtcc
ctgtctggaaaccaggctgtacgtctgcctttaatggagtgtgtgcagatgactcaggaa
gtacagaaggcaatggatgaagcaaggtttaaggaggctgtgcagcttcgaggaaggagt
tttgaaaataaccttaaaacctacaaattattgtctcatagaaaacaagatgcagagctt
ccaaagagtaattttaatgtggcagttttaaatgtaggtgcccctgcagctgggatgaat
gctgctgtgaggtctgcagtgagagttggcataactgaaggacacaaaatgtttgctatc
aatgacggatttgaaggttttgctaaggggcagataaagacaatcagctggggagatgtt
ggaggctggactggccaggggggatcaattctcggcacaaaacgaacccttcctgcaaag
tatttggagaagattgctgaccagatgcgcacttataatatcaatgcccttatggttatt
ggtggatttgaggcctatgaaagttgtctgcaattatatgaggcgcgttcccgctttgag
gagttttgcatacctatctgtgtattgcctgctactattagcaacaatgtaccaggcaca
gactttagcattggtgctgacactgccttgaatgctattgtagagacatgtgatcgcatc
aaacagtcagccagtgggaccaaacgtcgtgtgttcatcattgagaccatgggtggttac
tgcggttacctggccaatatggggggccttgctgcaggtgctgatgctgcttatatcttt
gaagagaagtttgatattcgagagctccaggctaatgtggaacatttgacggaaaagatg
aaaaccagcatccagcgtggtctagtgctgaggaatgaaaactgcaatgagaattacaca
actgacttcatctatcagctgtattctgaggaaggaaaaggtgtgtttgactgcagaaag
aatgtattgggtcacatgcaacaaggtggtgccccttctccgtttgacagaaactttggg
acgaaaatttctgcaaaagccattcagtggatctctaagaaacttgtggaaacataccgg
aaagaagaaggaaaagtatttgccaacaccgatgacactgtttgtctgctgggaatgcgc
cggcgcaatcttgttttccaacctgtggctgagcttaagggtgaaacagactttgtgcac
agaattgctaaggaacaatggtggctgaaactccggcccctgatgaaaattctggccaaa
tacaagactagctatgacgtctccgattcagggcagctggagcatgtagcgatgcataga
ccgaaagaagcagaaactggggccatctaa

DBGET integrated database retrieval system