KEGG   Alligator sinensis (Chinese alligator): 102373063Help
Entry
102373063         CDS       T02922                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00020  Citrate cycle (TCA cycle)
asn00190  Oxidative phosphorylation
asn01100  Metabolic pathways
asn01200  Carbon metabolism
Module
asn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
asn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
asn_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102373063 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102373063 (SDHB)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102373063 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_7 Fer4_18
Motif
Other DBs
NCBI-GeneID: 102373063
NCBI-ProteinID: XP_006023283
UniProt: A0A1U7RH01
LinkDB All DBs
Position
Unknown
AA seq 277 aa AA seqDB search
MAAAVVGVSLRRRIPGPVLRAAALQVCRGAQTAAAAASAPQTEPRIKKFAIYRWDPDKHE
DKPHMQTYEIDLNKCGPMVLDALIKIKNEMDATLTFRRSCREGICGSCAMNISGGNTLAC
TKRIDTNLDKVTKIYPLPHMYVVKDLVPDLSNFYAQYKSIEPYLKKKDESQQGKEQYLQS
IEDRQNLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDYREERLAQ
LQDPFSLYRCHTIMNCTKSCPKGLNPGKAIAEIKKMM
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccgtggtcggagtctccttgaggcgccgcatccccgggccggtgctgagg
gcggccgcgctgcaggtctgccgtggggcacagacagcagctgccgcagcttccgctccc
cagacagagccacggatcaagaaatttgctatctacagatgggatccggacaagcatgag
gacaagccccacatgcagacctatgagattgacttgaataagtgtgggcctatggtgctt
gatgctctgatcaagataaaaaatgagatggacgccaccttgaccttccgtaggtcatgt
agggaaggtatctgtggctcgtgtgctatgaacatcagtggtggcaacaccttggcctgt
actaaaagaatcgacaccaacctcgacaaagtcactaaaatctaccctctgccacacatg
tacgtggtgaaggatcttgttccagacttgagcaacttctatgcacaatacaaatccatt
gagccttacctgaagaagaaggatgaatcccagcagggtaaagagcagtacctgcagtcc
atagaagatcgccagaacttggatgggctgtatgagtgtattctgtgcgcctgctgcagt
accagctgtcccagttactggtggaacggagacaaatacctgggccctgcagtactgatg
caggcatatcggtggatgatcgattccagagacgactacagagaagagcggctggcacag
cttcaggacccattttccctctaccgctgccatacaatcatgaactgcacaaagtcctgc
cccaagggtttgaaccctggaaaagcaattgctgagatcaagaaaatgatgtaa

DBGET integrated database retrieval system