KEGG   Alligator sinensis (Chinese alligator): 102373099Help
Entry
102373099         CDS       T02922                                 

Gene name
KMT2D
Definition
(RefSeq) lysine methyltransferase 2D
  KO
K09187  histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    102373099 (KMT2D)
Enzymes [BR:asn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102373099 (KMT2D)
Transcription factors [BR:asn03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    102373099 (KMT2D)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102373099 (KMT2D)
   HMT complexes
    MLL-HCF complex
     102373099 (KMT2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD FYRC FYRN SET zf-HC5HC2H zf-HC5HC2H_2 HMG_box PHD_2
Motif
Other DBs
NCBI-GeneID: 102373099
NCBI-ProteinID: XP_014380936
UniProt: A0A1U8DKU7
LinkDB All DBs
Position
Un
AA seq 4595 aa AA seqDB search
MDEQKPPSEDKDSEAPADGAASSEEQGSAEGDPLKPPEVVPATREPGSTETKRPPQPCST
LPWRCALCNCGDWSRLGQRELQRFEPGPNWTEQPQGQEGPGEVPAAEDDLSQIGFTEGVT
LRQISEPTGHCWVHHWCAAWSAGVQRQDGTGLNDVDKAVFSGISQKCERCQRMGATLQCH
SEGCPRCYHFPCAAASGSFQSMKTLQLLCPEHLAEAAQMEDSRCVVCDGPGELRDLLFCT
SCGLHYHGACLEITVTPRKRAGWQCPECKVCQTCRQPGEDSMMLVCEACDKGYHTFCMKP
AIESLPTDSWKCKNCRVCSDCGRRPAALNPACQWYENYSVCEGCQEQRRRSTEGSQAGEA
EAPPCDQHSPLPMACIDSAGPPVPPSPAGHDPPVPSPLPQARSPAAEPQDKLPAADEAKP
PVGKQPGPRRWDLVPGGGPRQGGGDGGGAGTTAPPRNPSALAPSAPRPCSHTPASPAPGL
EPAGSPCISMDMEPPAASPAPPPSPPAAEPPSVAPLLGSPAHEGAQRGSEGEEMETAPEA
GALASPSGDGAQPSPAPALGPFPGLAEEEEDEEEEAPRLEREGASGHCSPQLSEEDGLEE
LRGVGDLESSQTPVSFASEPKGSPLLLEPEELGPATPMEVCGAGTKLLGRGEEGGPEPPA
LQPRPALIKSDIVNEISNLSQGDTSSSFPGSEPLLGSPDPEGGGSLSMELGMTSTDISLQ
KDDAALLPLGTDSLPETDDSLLFEPASGAKGEGEKGRRRSSPGRSRIKQGRSSSFPGRRR
PRGGSHGGRGRGRARLKSTTSSIETLALADVDSSPSKEDDEEDEDTMQNTVVLFSNTDKF
VLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVC
GKASDPSRLLLCDDCDVSYHTYCLDPPLQTVPKGGWKCKWCVCCVQCGAASPGFHCEWQN
NYTHCGPCASLVTCPVCREKYVEDDLLIQCRHCDRWLHASCDNLFTEEEVEQAADEGFDC
SACQPYVVKPVVPVAPAEITPMKMKEPEPQYFRFEGVWLTETGMAVLRNLTMSPLHKRRQ
RKTRPGALNGEGSLEGSDPLGPDEKKEGDLEGDELLKAEVGVEHMECEIKLEASASPDRD
GGADLDSGKGLEDLEECKKRKRKPYRPGIGGFMVRQRKSHTRPKKCPAVLAEAGREGLGA
EGHPEDGVPADIPAEGAAEPGVAEGDEKKKRRGRKKSKLEDMFPPYLQEAFFGKALMDMS
RKALLAAGGVGDGAVRPSFGQGAPRPKVDPSVPGALQGTPRDRKEAPTHLRGDDSMDGST
MMGQEDDSKDAEAKAEDLGAEEPKDSPDPGDAEKPATPGEGALSSDLDRIPMEELPKMES
KDVQQLFKDVLGSAEREQQLNCVAAGLEAGVAGRDPSRTQLPQRPFLQGGISLGSIPSSV
PMETYSGVCQSPFLDNRWVGGFFSPEHCEPESPWASSSAATTPSTPTTPTTEGEGDGLSY
NQRSLQRWEKDEELGELSTISPVLYANMNFPSLKQDYPDWSSRCKQIMKLWRKVPATDKA
PYLQKAKDNRAAHRINKVQKQAESQINKQTKGEGLRKPERPSLHLRIPMQPGALPSSAQP
PSTGGQPVYVNSAAGLPPSADGFLKQPAGTGGGADSPSELFLKLPPQSPAQVPSHDPYTM
ASTYPLEPRFSSPLGQSPTAGSGFQPFPPQPPQQLLPTPRPAPGPQSEFHPTSPGTPRHQ
PSTPDTFLKPRCPSGSLDNLGGRGAGPPEPLLSPPPFGEQKKGLDAAGLQVKKEEGALGV
CSPGYALAYADSPAGPHLSADLHKPPRPQMPESSYKTVPIPHSAPAGGGFPPAQPEPHAK
VPGSQQPPFIRSPGASVFPGAQAQMRFTFPPSVAEPLKGSPSHQPHGMNSHFAPSQALGK
PQSTSYASSPSFHQAGSPLGPGNATPETYSLSPLRPPSVLPQQAPQQQDVSLGYLPRPGL
VPSTDKREEVVAGITVPPSRELPELPVSQEGALNSMSQSELEKQRQRQRLRELLIRQQIQ
RNNLRQEKESAAAAAGSTPTAWGPDTSSQAFEQLSRGMAPYQPVQDKSILGSLPAVPSGT
KLPGPALVPAAYAQDERLARPPPSATPSAMDINGRTAVGPTQTFYPRAVFPGPTPQQQQQ
QQIWQGRQRRGEAYLCLLVSSSRQATSSGGQCWAPLSQLGLPCDVPVEPDLDDDFDTHKD
LEDDDLANLSLDPDVAKGDDDLDSLEANDPGDEFDLLAYTDPELDNGDKKDIFNEHLRLV
ESANEKAEREALLKTEPPTSGPRVPNAGERKEVAPPGRERVVVKEGPAPGMGLSSASCPS
GPVPAPDPAFKAQGSVLEAKMGPLPADIKPKLEEGCLKTSPCQFTTSGPDRLPGPIKAEA
LQGAERVAATLGLNLKPGQALLSQGAGPARLSMGHFPDKGHPAAPGSDKDPYAGPGRGLA
PGQVAPPGSALLEKFELDGGALGLANTQHSPGDDLDKMESSLVASELPLLIEDLLEHEKK
ELQKKQQLSAQLPSGTAPLQPSHAMLPAQPQPHDTQAPRLVGPQMQLGLVARQQGLVAPQ
QLMAQQQPQQRLAGAPQGQGQGPHMALAQPPPHALVASSAVPAALAQQKQLAGVQPSSLG
LKQQQLVLQQQLSGSFLADLDKFAAEDIMDPIAKAKMVALKGIKKVMAQGSIGVAPGMNR
QQVSLLAQRLSGAPATAEMQNHILTGSGQERSSTDPAQARPNPPTFAQGVINEADQRQYE
EWLFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADAEKLKLVTEQQ
SKIQKQLDQVRKQQKEHTNLMAEYRNKQQQHQQSSAVLALSPSQSPRLMAKLPGQLLPAH
GVQPSLSQPGATMVGAPGLGQSQGQLVGQAAGLRPPQGSSGVPMAVQQGLSFMGQQQLGN
AAVPGTSNSFFPGPGGQTMVPKQQGLMGNQQGILVQQLSPQQPPQPGMQGHPPAPTLQHQ
GKGHQPRQLLLAPHQQRVLGSPQLGQQAPGLLGHRLVLSQQQQQQVGLLGPARTLLTPQQ
QNSLAQHQPGALLHQPLPGDPTAGAARQDTPQLHANPSPGPPQPGLPVSEPPQSCAMSQA
QSIMVQQQQQRIVGHPQLPSRLQSMVGPPRPGLQQQGLLLPPAAHAQSLLGQVPGPVLGQ
IRAQLQGVLAKNPQLRHLTPQQQQQLQALLVQRHQQNLLQHSQALRQAGPFPGQESGQPG
TAPHAPPPAPPRQLGTLFQVRSAGPVPEPGLGMERVPAGAPHPQPLAELVHGGRSPQPAM
LRLSTTSAPPTIQSPLSVLSLGPAPPQHPVPSPEQGTQEPKKASPSLLAQTPVALPEQRP
APPHSGLLPEPPKPDPSPAPPKPTSSQSREEPFPVPPSPWDPAAQGPIAPPGTEPAKARL
PMVPISGQAPEVPRTETLLPEAGGPLAMPPGVCVKQEPKEEGVPCELAAEQLLKPEAHRE
QPAAPTPANHHLLGSQLLAGAPPEAGHLLLQKLLRAKNVQLVSQRTAEGLHPELNGHADG
KLAALEHRLQAVAPGREDPSAAKKLLAPKPKRVQKGNERVPTSRKKLRKDDGLKPSEALM
KQLKQELSLLPLMEPTITANFSLFPPFGSSPINGRSPLKGAFGSAVLESVPDYYSQLLSK
NNLSNPPTPPSSLPPTPPPSVQQKMVNGVTSGEELPEQPKDPAREPEGHKDAPAVEVKSL
DLLAALPTPPHNQTEDVRMESDEESDSPDSIVPASSPESILGEDVPRFPLLTETRPELEE
RVLSPVIPIIPRASIPAFPDTKPYEAPEPFGERSAKAPLTQGVPWEKGKGSEVSVMLTVS
AAAAKNLNSVMVAMAELLSMKIPNSYEVLFSESPMRAAGPEAKKVETDGAGTDKPGKPPD
GNAEWLKQFDAVLPGYSLKSELDILTLLKQESPAAEKAAQHCYIHNVSNLDVRQLSLPPE
EPSPPLSPFAPSPSSPAETACIPAAEAAPEAAPVPSTPSPPAPSPAPKEEGSLSPSRAKP
RARPPEDGSGDEVRPRLKKWKGVRWKRLRFLLTIQKGGAKRDGDREIAEFVEKLGSALRP
EKVPRDLRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALINVEV
ALHRGLLTKCSLCQKMGATNSCNRLRCPSVYHFACAIRAKCMFFKDKTMLCPLHKPKGPC
DQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQMADFHSV
TALYPVGYEATRIYWSLRTNNRRCCYRCTICENNGRPEFVVQVIEQGLEDLVFTDSSPQA
VWNRIIEPVAMMRKDADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVESCTNYLFRYG
RHPLMELPLMINPTGCARAEPKILTHYKRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVH
SKSSQYRRLKTEWKNNVYLARSRIQGLGLYAAKDIEKHTMVIEYIGTIIRNEVANRREKI
YEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRI
PKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN
NT seq 13788 nt NT seq  +upstreamnt  +downstreamnt
atggatgagcagaagccgcccagcgaggacaaagactctgaggcgccagctgacggagcc
gcgtcctcagaggagcagggcagcgcggagggagatccgctgaagcccccggaagtggtg
cctgccacgcgggagccagggagcactgagacaaagcggcccccacagccctgcagcacc
ctgccctggcgctgcgccctctgcaactgtggggactggagccggctggggcagcgggag
ctccagcgctttgagccagggcccaactggacggagcagccacaggggcaggagggccct
ggcgaggtcccggctgccgaggacgacctgtcccagatcggcttcacagaaggggtgacg
ctgagacagatctcggagccgacggggcactgctgggttcaccactggtgtgcggcctgg
tcggcgggggtgcagcggcaggacggaacagggctgaatgatgtggacaaagctgttttc
tcagggatctcgcagaaatgtgaacgctgtcagaggatgggtgctacccttcagtgccac
tcggagggctgtccgcggtgctaccacttcccctgtgcggctgctagcggctctttccag
tctatgaagaccctccagctcctgtgcccagagcacctagctgaggcggcgcagatggag
gactcgcggtgcgtggtgtgtgatgggccaggcgagctgcgcgacctgctgttttgcacc
agctgtgggctgcactaccacggcgcctgcctggagatcactgtcacgccccgcaagcgt
gccggctggcagtgccccgagtgtaaagtttgccaaacctgcaggcagcccggcgaagac
tccatgatgctggtgtgcgaggcctgcgacaagggctaccacaccttctgcatgaagcca
gccatcgagagcctccccaccgactcctggaagtgtaagaactgccgggtgtgctcagac
tgtgggcggcggccagcggctctcaaccctgcgtgccagtggtacgagaactactcggtg
tgtgaggggtgccaagagcagcggcgccgcagcacggagggcagccaggcgggtgaagcc
gaagccccaccatgcgaccagcactcaccgctgcccatggcctgcatcgactcggcgggc
ccccccgtgcccccgtcccccgcggggcacgacccacctgtgccctcacccctgccgcag
gccaggagccctgcagcagagccccaggacaagctgccagctgcggacgaagccaagccg
cccgttggcaagcaacctgggccccgccggtgggacctggtgcctggcggaggcccccgc
caaggaggaggcgatggaggtggagctggaaccaccgcccctccccgcaaccccagcgcc
ctcgcccccagcgcccccagaccttgctcccacacccccgcctcccctgcccccgggctg
gagcctgcgggcagcccctgcatctctatggacatggagcctcctgccgcctcccccgcc
ccaccgccctcaccacccgctgccgaaccgccctccgtggcgcccctgttgggctccccg
gcccacgagggagcccagcggggtagtgagggggaggagatggagacggccccggaggcc
ggggcgctggccagcccctcgggggacggagctcagcctagcccagccccggcactgggg
cccttcccgggcctggcagaggaagaggaggatgaggaagaggaggcgccgaggctggag
cgggagggggccagcgggcactgctcaccccagctgagcgaggaggacgggctggaggag
ctgcggggcgtgggggaccttgagtccagccagaccccggtcagcttcgccagcgagccc
aagggctcgcccctgctgctggagcctgaggagctgggtccggccacccccatggaggtg
tgcggggcaggcacgaagctgctgggccgcggggaggagggcggccctgagcccccggcc
ctgcaaccccgaccagccctcatcaagtcggacattgtcaacgagatttccaacctgagc
cagggtgacaccagcagcagcttccccgggtcagaacccctgctgggctcacctgatccc
gagggcgggggctcactctccatggagctgggcatgacgtccaccgatatcagcctgcag
aaggatgatgctgctctgctaccccttggcaccgactcgctacctgagacggatgactcg
ctgctttttgagccggcttctggggccaagggtgaaggagagaagggccggcggcgcagc
tcccctgggcggtccagaatcaagcagggtcgcagcagcagtttccccgggaggaggcgc
ccccgcggcgggtcccacgggggtcgtggtcgcggccgtgcccggctgaagtcaaccact
tcgtccatcgagacccttgcgctggcagatgtggacagctcccccagcaaggaggacgac
gaggaggacgaggacactatgcagaacacggttgtactcttttccaacacggacaagttc
gttctcatgcaggacatgtgtgtggtgtgcggcagctttgggcgtggggctgaggggcac
ctgctggcctgttctcagtgctcccagtgctaccatccctactgtgtcaacagcaagatc
accaaagtgatgctgctgaagggttggcgttgcgtggagtgtattgtgtgcgaggtctgt
ggcaaagcctcagacccctcacgcctgctgctgtgcgacgactgtgacgtcagctaccac
acttactgcctggacccgccgctacagactgtgcccaagggtggctggaagtgcaagtgg
tgcgtgtgctgtgtgcagtgtggggcggcctcgcccggcttccactgcgagtggcagaac
aactacacgcactgcggcccctgtgccagcctagtcacctgccccgtctgccgggagaag
tacgtggaagacgacctgctcatccagtgccgccactgtgaccggtggctccacgcctcg
tgtgacaacctcttcacggaggaggaggtggagcaggcggcagacgagggcttcgattgc
agcgcctgccagccctatgtggtcaagcctgttgtgcccgtggcccctgcagagatcacc
ccgatgaagatgaaggagccagagccccagtacttccgcttcgagggtgtctggctgact
gagactggcatggccgtgctccgcaacttgaccatgtccccactgcacaagcggaggcag
cgcaaaaccaggccaggggccctcaacggggagggcagcttggagggcagcgaccccctg
ggccccgacgagaagaaggagggggacctggaaggggatgagctgctgaaggctgaagtg
ggtgtggagcacatggagtgcgagatcaagctggaagcctctgccagccctgaccgggat
ggtggggctgacctggattcggggaaggggctggaggacctggaggagtgcaagaagagg
aagcggaagccataccgtcctgggatcggtggcttcatggtgcggcagcgcaagtctcac
acgcgtccgaagaaatgcccggctgtgctggcagaggcggggcgcgaggggctgggtgct
gagggacaccctgaggatggggtgccagcagacatcccggctgagggtgctgccgagcca
ggggtggccgagggtgatgagaagaagaagcggcggggtaggaagaagagcaaactggag
gacatgttccccccatacctgcaggaagcgttctttggcaaggcactcatggacatgagc
cggaaggccctgctggcagctggcggtgtgggtgacggagccgtccgcccctcctttggc
cagggcgccccccgacccaaggtggaccccagcgtgcccggggccctccaaggcacgccc
agagaccggaaggaggcccccactcacttgagaggggatgacagcatggatggcagcacc
atgatgggccaggaggatgactcgaaggacgcagaggcaaaagccgaggacttgggggca
gaggagccaaaggactcgccggatcccggggatgctgagaagccagcgacgccgggtgag
ggcgcgctcagctccgacctcgacaggatccccatggaagagctgcccaagatggagagc
aaggatgtgcagcagctcttcaaggatgtgctgggctccgcggagcgggagcagcagctg
aactgcgtggcagcagggctggaggccggcgtggcggggcgagaccccagccggacccag
ctcccacagaggcctttcctgcagggaggtatttctctgggatcgatcccctccagtgtc
cctatggagacctattctggagtctgccagtcccccttcctggacaacaggtgggtaggc
ggcttcttcagcccagagcactgcgagccggagagtccctgggccagcagctctgctgcc
accacaccctccacgcccacgacgcccaccacagagggcgagggtgatgggctgtcctac
aaccagcgcagcctgcagcgctgggagaaggacgaggagctgggcgagctctccaccatc
tcacccgtgctctatgccaacatgaacttccccagcctcaagcaggactatccagactgg
tccagccgctgcaagcagatcatgaagttgtggaggaaggtgcctgccacagacaaagct
ccctacttgcaaaaggccaaagataatcgggcggctcatcgcatcaacaaggtgcagaag
caggctgagagccagatcaacaagcagaccaaaggggagggcctgcgcaagcctgagagg
ccctcgctgcacctgcggatcccaatgcagccgggggcgctgcccagctccgcccagccc
cccagcaccggcgggcagcctgtctacgtcaacagtgcagccggcctgcccccctcggcc
gacggctttctgaagcaacctgcgggcaccggagggggagccgattcgcccagtgagctc
ttcctcaagctcccgccccagtcccctgcccaagtgccttcccacgatccctacaccatg
gcctccacgtacccactcgagccgcgcttctcctctcccctgggccagagtcccacagcg
ggctctggattccagcccttcccaccccagcccccgcagcagctcctgcccacaccccgg
ccagctcccggcccccagtctgagttccaccccacctcacccgggaccccccggcaccag
ccctccaccccggacacctttctgaagccccggtgccccagcggctccctggataacctc
ggcggccgcggcgccggccccccggagccgctgctctcacccccaccctttggggaacag
aagaagggcctggatgcagcagggctgcaggtcaagaaggaggaaggggctctgggcgta
tgctctcccgggtatgccctggcctacgccgactccccggccggcccccacctctctgca
gacctgcacaaacccccccggccccagatgccggagtccagctacaagacggtaccaatc
ccgcacagcgctccagctggagggggcttccccccagcacagcccgagccccatgccaag
gtgccggggagccaacagccccccttcatccgctcgcctggtgccagcgtcttccctggt
gcccaggcccagatgcgcttcaccttcccaccctcggtcgcagagccgctcaagggctcc
ccctcccaccagcctcatgggatgaacagccattttgccccgagccaggccctgggcaag
ccccagagcaccagctatgcctcctcgcccagcttccaccaggccggcagccccctgggg
ccaggcaacgccacccctgagacctacagcctctccccgctgcggcccccatcggtgctc
ccccagcaggccccgcagcagcaggatgtcagccttggctacctgcctcgaccgggcctg
gtgccatccaccgacaagagggaggaggttgtggcaggcatcacggtgccccccagccgg
gagctgccggagctgcccgtcagccaggagggtgccctcaacagcatgagccagtcggaa
ctggagaaacagcggcagcggcagcgactccgcgagctgctcatccgccagcagatccag
aggaacaacctgcggcaggagaaggagagtgcggccgccgcagccggctccaccccgaca
gcctggggccccgataccagctcccaggcctttgagcagctcagccggggcatggcacca
taccagcctgtgcaggacaagagcatcctggggagcctgcccgcagtgcctagtggtacc
aagctacccggcccagccctggtgccagccgcctacgcccaggacgagcgcctggcccgg
ccacccccctcagccacgccctccgccatggacatcaacggcaggacggcagtgggaccc
acgcagacgttctacccccgcgccgtattcccggggcccacaccgcagcagcagcagcag
cagcagatatggcaggggcggcagcgccggggggaggcctacctgtgtctactcgtttcc
agcagccgccaggccacgagctcgggcggccagtgctgggcccccctgagccaactgggg
ctgccatgtgacgtcccggtagagcctgacttggatgacgactttgacacccacaaggac
ctggaggacgacgacttggccaacctgagcctagaccccgatgtggccaagggtgatgac
gacctggatagcctggaggccaacgaccccggggatgagtttgacctgctggcctacact
gaccccgagctggacaacggtgacaagaaggacatcttcaatgagcacctgcgcctggtg
gagtcggccaatgagaaggctgagcgcgaggccttgctgaagacagagccgcccacgtct
ggcccaagggtccccaatgctggggagcgcaaggaggttgcaccgcctgggagggaaagg
gtggtggtcaaggaggggccagctccgggcatggggttgtcctctgcctcctgcccctct
gggcccgtgccagcccctgaccccgccttcaaggcacagggcagtgtcctggaggccaag
atgggcccactgccggcagacatcaagcccaaactggaggaaggctgcttgaagacgtca
ccctgccagtttactaccagcggccctgaccggctcccgggccccatcaaggctgaggct
ctccagggagctgagagagtggctgctaccctcgggctgaacctcaagccaggccaggcc
ctcctgagtcagggtgcagggccagcgcggctcagcatgggccatttccctgacaaaggc
caccctgccgcccctggctcggacaaggacccttatgctggccctgggcgtgggctggcg
cctggccaggtagccccaccaggcagcgccttgctggagaagtttgagttggacggaggt
gccttgggcctggccaacacccagcactcaccaggtgatgatctggacaaaatggagagt
tccctggtggccagtgagctgccgctgctcattgaggacctactggagcacgagaagaag
gagctacagaagaagcagcaactgtcagcccagctgcccagcggcactgcacctctgcag
ccctcgcatgccatgctgccggcccagccccagccccacgacacgcaggctccccgcctg
gtggggccacagatgcagctgggcctggtcgcacggcagcagggcctggtagccccccag
cagctgatggcacagcagcagccgcagcagcgcctggcaggagccccacagggccagggc
cagggcccccacatggcactagcgcagcccccacctcatgcacttgtggcctcctctgct
gtccctgcagccctggcccagcagaagcagctggctggggtgcagccctccagcctgggc
ctgaagcagcagcagcttgtcctgcagcagcagctgagcggctccttcctcgcagaccta
gataagtttgcagctgaggacatcatggaccccatcgccaaggcaaagatggtggcgctg
aagggcatcaagaaggtgatggcacagggcagcattggcgtggcccccggcatgaacagg
caacaggtgtccctgctggcccagcggctgtcaggagccccagccacggctgagatgcag
aaccatatcctgactgggagtgggcaggagcggagcagcactgacccagcccaggctcgc
cccaaccccccgacctttgctcagggcgttatcaacgaggccgaccagcggcagtacgag
gagtggctcttccacacgcagcagctgctgcagatgcaactcaaggtgctggaggagcag
attggtgtccaccgcaagtcccgcaaagcgctgtgcgccaagcagcgcaccgccaaaaag
gctgggcgggagtttcctgaggccgatgctgagaagctcaagctggtcacggaacagcag
agcaagatacagaagcagctggaccaggtccgcaagcagcagaaggagcacaccaacctg
atggctgagtaccgcaacaagcagcagcagcaccagcagagctcggctgtgctggccctc
agcccctcgcagagcccgcgcctcatggccaagctccccgggcagctgctgccagcgcat
ggtgtccaaccatccctgtcccagccaggagccaccatggtgggcgccccaggcctgggc
caatcccaaggacagctggtggggcaggcggctggcctgcgccctccccaaggcagcagc
ggagtccctatggcagtccagcaaggcctgtcgttcatgggccagcagcagctggggaat
gcggccgtgcctgggacctccaacagcttcttcccaggcccggggggccagactatggtc
ccaaagcagcaaggattgatgggaaaccagcagggcatcctggtgcagcagctctccccg
cagcagccgccgcaaccaggcatgcaggggcaccccccagcgcccacgctgcagcaccag
gggaagggccaccagccacgccagctgctgctggccccccaccagcagagggtgctgggg
tcgccccagctggggcagcaggcgcctggcctcctggggcaccgcctcgtcctgtcccag
cagcagcagcagcaggtcgggctcctggggccggcacggacactgctgacgccacagcag
cagaactctctagcacagcaccagcctggtgccctgctgcaccagcccctgcctggtgac
ccgacagcaggagctgccaggcaggacacaccacagctgcacgcgaatcccagcccgggg
ccaccccagccgggcttgccagtatcggagccaccgcagagctgtgccatgagccaggca
caaagcatcatggtgcagcagcagcagcaaaggattgtggggcacccccagctgccctca
cggctgcagagcatggtggggccaccccgacctgggctgcagcagcagggcctgctgctc
ccgcctgcagcccatgcgcagagcctgctgggccaggtgccggggccagtgctggggcag
atccgggcgcagctgcagggtgtgctggccaagaacccgcagctgcggcacctcacacca
cagcagcagcagcagctgcaggccctgctcgtgcagcgccaccagcagaacctgctgcag
cacagccaggcactgcgccaggccggccccttcccagggcaggagtccgggcagccaggc
acggctccccatgcccctccacctgccccgccccgccagctgggcactctcttccaggtg
cgctcagctggcccggttcctgagccggggcttggcatggagcgggtgcctgcaggggcc
ccccacccgcagccgctggcagagctggtccatggcggtcgcagcccccagccagccatg
ctacgactgtccaccacatcggcaccccccaccatccagtcgcccctaagtgtgctcagc
ctgggccccgcaccaccacagcaccctgtgcccagcccagaacagggcacccaagagcca
aagaaagcctccccttccctcctggcacagacccctgtagccctgccggagcagcggcca
gcacccccccacagtgggctcctgcctgagccacccaagcctgacccctctcctgctccc
cccaagccaacctccagccagagcagggaggagcccttcccagtgccccccagcccttgg
gatcccgcggcacaggggcccattgctcctcctggtacggagcccgcgaaggcacgcctg
cccatggtccccatcagtgggcaggcacctgaagtgccccgcacagagactttgctgcct
gaagctggggggccactggccatgccccctggagtgtgcgtcaagcaggagcccaaggag
gagggagtgccgtgtgagctagctgcggagcagctcctgaagcctgaggcccacagggag
cagccggcagcacccaccccggccaaccaccacctgctgggcagccagctgctggcgggt
gcccccccagaggctgggcacctgctgctgcagaagctgctgcgggccaagaatgtgcag
ctggtatcacagcgcactgccgaggggctgcaccctgagctcaacgggcatgctgatggc
aagctggccgcgctggagcacaggctgcaggctgtggccccaggcagggaggacccatct
gccgccaagaagctgctggccccaaagcccaagcgggtgcagaagggcaatgagcgggtc
cccacctcccgcaagaagctgcgcaaggatgatggcctgaagcccagtgaggccctcatg
aagcaactgaagcaggagctctccctcctgcccctgatggagccgaccatcacggccaac
ttcagcctcttcccgccctttggcagcagccccatcaatggccggagccctctcaagggt
gccttcggcagcgctgttctggaaagcgtccccgactactactcccagctactatccaag
aacaacctgagcaacccaccaacgccgccctcatcgctgccccccaccccgcccccctcg
gtgcagcagaagatggtgaatggtgtcacctccggcgaggagttgcctgagcagcccaag
gacccggcccgtgagcccgagggccacaaggatgctcctgccgtggaagtgaagagcttg
gacctgctggcggccctacccacaccaccgcacaaccagactgaggatgtccggatggag
agcgatgaggagagtgactcccccgacagcatcgtgcctgcctcgtccccggagagcatc
cttggggaggatgtgccccgctttcccctgctgacggagacgcggccggagctggaagag
cgcgtgctgtcccccgtcatccccatcattcccagggccagcatcccagccttccctgac
accaagccctacgaagcaccggagccctttggggagcgctctgcgaaggccccgctgacg
cagggagtcccctgggagaagggcaagggcagtgaggtctccgtcatgctgaccgtctct
gctgcagcagccaagaacctgaacagcgtcatggtggccatggccgagctgctgagcatg
aagatccccaactcctatgaggtgctgttctctgaaagccctatgcgggccgctgggccc
gaggccaagaaggtggagactgatggagccggcactgacaaacctgggaagccgcctgac
ggcaatgcggagtggctgaagcagttcgacgccgtgttgccaggctacagcctcaagagc
gagctggacatcctgacacttctcaaacaggagagcccggcagcagagaaggcggcacag
cactgctacatccacaacgtgtccaacctggacgtgcggcagttgtcactgccacccgag
gaaccctcgcccccgctttcccccttcgccccatcgccctccagccctgccgaaaccgcc
tgcatcccggctgccgaggccgcccctgaggcagcaccagtgccctccactccatcccca
cctgccccttccccagcccccaaggaggaggggtcactctcgccatcccgggccaagcca
cgcgcacggcctccggaggatggcagtggggatgaggtgcggccgcggctgaaaaagtgg
aagggggtgcggtggaagcgtctgcggttcctgctcaccatccagaaaggtggggccaag
cgagatggcgaccgggagatcgctgagtttgtggagaagctgggctcagccctgcggcca
gagaaggtgccgcgggacctgcggcgctgctgcttctgccatgaggagggcgatggtgcc
acggacggccctgcccgcctcctcaacctggacctggatctctgggtgcacctgaattgc
gccctgtggtccacagaggtgtatgagacgcagggcggggccctcatcaatgtggaggtg
gcgttgcaccgggggctgctgaccaagtgctccctgtgccaaaagatgggtgccaccaac
agctgcaaccgcctgcgctgccccagcgtctaccactttgcctgcgccatccgcgccaag
tgcatgttcttcaaggacaagaccatgctgtgccccctgcacaagcccaagggcccctgc
gaccaggagctgagctcctttgccgtcttccggcgcgtctacattgagcgcgacgaggtc
aagcagattgccagcatcatccagcggggcgagcgcctgcacatgttccgcgtgggtggc
ctggtcttccacgccatcggccagctgctgccccaccagatggccgacttccacagcgtc
acggccctctaccccgtgggctacgaggccacacgcatctactggagcctgcgcaccaac
aaccggcgctgctgctaccgctgcaccatctgcgagaacaacgggcgccctgagtttgtg
gtgcaggttatcgagcaggggctagaggacctggtcttcactgattcctcgccccaggcc
gtgtggaaccgcatcattgagccggtggccatgatgaggaaggacgctgacatgctgcgg
ctgttccctgagtacctgaagggggaagagctcttcggcctcacggtgcacgccgtgctg
cgcatcgccgagtctctgcctggcgtcgagagctgcacaaactacctgttccgctatggg
cgccatccgctaatggagctgccactcatgatcaaccccactggctgcgcccgggctgag
cccaagatcctcacccactacaagcggccccacaccctgaacagcacgagcatgtccaag
gcctaccagagcaccttcacgggcgagaccaacacgccctacagcaagcagttcgtgcac
tccaaatcctcacaatatcggcgcctcaagaccgagtggaagaacaacgtttacctggcg
cgctcccgcattcaggggctggggctgtatgcagctaaagacatcgagaaacacaccatg
gtcatcgagtacatcggcaccatcatccgcaacgaggtggccaaccggcgcgagaagatc
tatgaagagcagaaccgagggatctacatgttccgcatcaacaacgagcacgtcatcgac
gccacgctgacggggggcccggccaggtacatcaatcactcatgcgccccaaactgcgtg
gccgaggtggtgaccttcgacaaggaagataagatcatcatcatctccagccgccgcatc
cccaaaggggaggagctgacctacgactaccagttcgacttcgaggatgatcagcacaag
atcccctgccactgcggagcctggaactgccggaagtggatgaactag

DBGET integrated database retrieval system