KEGG   Alligator sinensis (Chinese alligator): 102373099Help
Entry
102373099         CDS       T02922                                 

Gene name
KMT2D
Definition
(RefSeq) LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 2D
  KO
K09187  histone-lysine N-methyltransferase MLL2 [EC:2.1.1.43]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102373099 (KMT2D)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:asn03000]
    102373099 (KMT2D)
   03036 Chromosome and associated proteins [BR:asn03036]
    102373099 (KMT2D)
Enzymes [BR:asn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102373099 (KMT2D)
Transcription factors [BR:asn03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    102373099 (KMT2D)
Chromosome and associated proteins [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102373099 (KMT2D)
   HMT complexes
    MLL-HCF complex
     102373099 (KMT2D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PHD FYRC FYRN SET zf-HC5HC2H zf-HC5HC2H_2 HMG_box
Motif
Other DBs
NCBI-GeneID: 102373099
NCBI-ProteinID: XP_025047151
LinkDB All DBs
Position
Unknown
AA seq 4785 aa AA seqDB search
MDEQKPPSEDKDSEAPADGAASSEEQGSAEGDPLKPPEVVPATREPGSTETKRPPQPCST
LPWRCALCNCGDWSRLGQRELQRFEPGPNWTEQPQGQEGPGEVPAAEDDLSQIGFTEGVT
LRQISEPTGHCWVHHWCAAWSAGVQRQDGTGLNDVDKAVFSGISQKCERCQRMGATLQCH
SEGCPRCYHFPCAAASGSFQSMKTLQLLCPEHLAEAAQMEDSRCVVCDGPGELRDLLFCT
SCGLHYHGACLEITVTPRKRAGWQCPECKVCQTCRQPGEDSMMLVCEACDKGYHTFCMKP
AIESLPTDSWKCKNCRVCSDCGRRPAALNPACQWYENYSVCEGCQEQRRRSTEGSQAGEA
EAPPCDQHSPLPMACIDSAGPPVPPSPAGHDPPVPSPLPQARSPAAEPQDKLPAADEAKP
PVGKQPGPRRWDLVPGGGPRQGGGDGGGAGTTAPPRNPSALAPSAPRPCSHTPASPAPGL
EPAGSPCISMDMEPPAASPAPPPSPPAAEPPSVAPLLGSPAHEGAQRGSEGEEMETAPEA
GALASPSGDGAQPSPAPALGPFPGLAEEEEDEEEEAPRLEREGASGHCSPQLSEEDGLEE
LRGVGDLESSQTPVSFASEPKGSPLLLEPEELGPATPMEVCGAGTKLLGRGEEGGPEPPA
LQPRPALIKSDIVNEISNLSQGDTSSSFPGSEPLLGSPDPEGGGSLSMELGMTSTDISLQ
KDDAALLPLGTDSLPETDDSLLFEPASGAKGEGEKGRRRSSPGRSRIKQGRSSSFPGRRR
PRGGSHGGRGRGRARLKSTTSSIETLALADVDSSPSKEDDEEDEDTMQNTVVLFSNTDKF
VLMQDMCVVCGSFGRGAEGHLLACSQCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVC
GKASDPSRLLLCDDCDVSYHTYCLDPPLQTVPKGGWKCKWCVCCVQCGAASPGFHCEWQN
NYTHCGPCASLVTCPVCREKYVEDDLLIQCRHCDRWLHASCDNLFTEEEVEQAADEGFDC
SACQPYVVKPVVPVAPAEITPMKMKEPEPQYFRFEGVWLTETGMAVLRNLTMSPLHKRRQ
RKTRPGALNGEGSLEGSDPLGPDEKKEGDLEGDELLKAEVGVEHMECEIKLEASASPDRD
GGADLDSGKGLEDLEECKKRKRKPYRPGIGGFMVRQRKSHTRPKKCPAVLAEAGREGLGA
EGHPEDGVPADIPAEGAAEPGVAEGDEKKKRRGRKKSKLEDMFPPYLQEAFFGKALMDMS
RKALLAAGGVGDGAVRPSFGQGAPRPKVDPSVPGALQGTPRDRKEAPTHLRGDDSMDGST
MMGQEDDSKDAEAKAEDLGAEEPKDSPDPGDAEKPATPGEGALSSDLDRIPMEELPKMES
KDVQQLFKDVLGSAEREQQLNCVAAGLEAGVAGRDPSRTQLPQRPFLQGDLQLPGQGGIS
LGSIPSSVPMETYSGVCQSPFLDNRXRSGFFSPEHCEPESPWASSSAATTPSTPTTPTTE
GEGDGLSYNQRSLQRWEKDEELGELSTISPVLYANMNFPSLKQDYPDWSSRCKQIMKLWR
KVPATDKAPYLQKAKDNRAAHRINKVQKQAESQINKQTKGEGLRKPERPSLHLRIPMQPG
ALPSSAQPPSTGGQPVYVNSAAGLPPSADGFLKQPAGTGGGADSPSELFLKLPPQSPAQV
PSHDPYTMASTYPLEPRFSSPLGQSPTAGSGFQPFPPQPPQQLLPTPRPAPGPQSEFHPT
SPGTPRHQPSTPDTFLKPRCPSGSLDNLGGRGAGPPEPLLSPPPFGEQKKGLDAAGLQVK
KEEGALGVCSPGYALAYADSPAGPHLSADLHKPPRPQMPESSYKTVPIPHSAPAGGGFPP
AQPEPHAKVPGSQQPPFIRSPGASVFPGAQAQMRFTFPPSVAEPLKGSPSHQPHGMNSHF
APSQALGKPQSTSYASSPSFHQAGSPLGPGNATPETYSLSPLRPPSVLPQQAPQQQDVSL
GYLPRPGLVPSTDKREEVVAGITVPPSRELPELPVSQEGALNSMSQSELEKQRQRQRLRE
LLIRQQIQRNNLRQEKESAAAAAGSTPTAWGPDTSSQAFEQLSRGMAPYQPVQDKSILGS
LPAVPSGTKLPGPALVPAAYAQDERLARPPPSATPSAMDINGRTAVGPTQTFYPRAVFPG
PTPQQQQQQQIWQGRQRRGGLPVSTRFQQPPGHELGRPVLGPPVSGLASRMPGPAEPLPA
SPGAIGPQFIELRHNVQKAAPGAVGPPFAQQGPPARPRFFLPGDETSGPAARTSILPMQP
AVLGGPVLQPQKMPVPLPPSSASSQGAEMSNSHHPPLTKGPSLPLPSASLELPHVPPRPL
SSAGTGPRPEGPKDDAAAPAPGSASASGRSQLGLPCDVPVEPDLDDDFDTHKDLEDDDLA
NLSLDPDVAKGDDDLDSLEANDPXXXXXXXXXXXLNGDEFDLLAYTDPELDNGDKKDIFN
EHLRLVESANEKAEREALLKTEPPTSGPRVPNAGERKEVAPPGRERVVVKEGPAPGMGLS
SASCPSGPVPAPDPAFKAQGSVLEAKMGPLPADIKPKLEEGCLKTSPCQFTTSGPDRLPG
PIKAEALQGAERVAATLGLNLKPGQALLSQGAGPARLSMGHFPDKGHPAAPGSDKDPYAG
PGRGLAPGQVAPPGSALLEKFELDGGALGLANTQHSPGDDLDKMESSLVASELPLLIEDL
LEHEKKELQKKQQLSAQLPSGTAPLQPSHAMLPAQPQPHDTQAPRLVGPQMQLGLVARQQ
GLVAPQQLMAQQQPQQRLAGAPQGQGQGPHMALAQPPPHALVASSAVPAALAQQKQLAGV
QPSSLGLKQQQLVLQQQQQEQEHGSFLADLDKFAAEDIMDPIAKAKMVALKGIKKVMAQG
SIGVAPGMNRQQVSLLAQRLSGAPATAEMQNHILTGSGQERSSTDPAQARPNPPTFAQGV
INEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQRTAKKAGREFPEADA
EKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQQHQQSSAVLALSPSQSPRLMA
KLPGQLLPAHGVQPSLSQPGATMVGAPGLGQSQGQLVGQAAGLRPPQGSSGVPMAVQQGL
SFMGQQQLGNAAVPGTSNSFFPGPGGQTMVPKQQGLMGNQQGILVQQLSPQQPPQPGMQG
HPPAPTLQHQGKGHQPRQLLLAPHQQRVLGSPQLGQQAPGLLGHRLVLSQQQQQQVGLLG
PARTLLTPQQQNSLAQHQPGALLHQPLPGDPTAGAARQDTPQLHANPSPGPPQPGLPVSE
PPQSCAMSQAQSIMVQQQQQRIVGHPQLPSRLQSMVGPPRPGLQQQGLLLPPAAHAQSLL
GQVPGPVLGQIRAQLQGVLAKNPQLRHLTPQQQQQLQALLVQRHQQNLLQHSQALRQAGP
FPGQESGQPGTAPHAPPPAPPRQLGTLFQVRSAGPVPEPGLGMERVPAGAPHPQPLAELV
HGGRSPQPAMLRLSTTSAPPTIQSPLSVLSLGPAPPQHPVPSPEQGTQEPKKASPSLLAQ
TPVALPEQRPAPPHSGLLPEPPKPDPSPAPPKPTSSQSREEPFPVPPSPWDPAAQGPIAP
PGTEPAKARLPMVPISGQAPEVPRTETLLPEAGGPLAMPPGVCVKQEPKEEGVPCELAAE
QLLKPEAHREQPAAPTPANHHLLGSQLLAGAPPEAGHLLLQKLLRAKNVQLVSQRTAEGL
HPELNGHADGKLAALEHRLQAVAPGREDPSAAKKLLAPKPKRVQKGNERVPTSRKKLRKD
DGLKPSEALMKQLKQELSLLPLMEPTITANFSLFPPFGSSPINGRSPLKGAFGSAVLESV
PDYYSQLLSKNNLSNPPTPPSSLPPTPPPSVQQKMVNGVTSGEELPEQPKDPAREPEGHK
DAPAVEVKSLDLLAALPTPPHNQTEDVRMESDEESDSPDSIVPASSPESILGEDVPRFPL
LTETRPELEERVLSPVIPIIPRASIPAFPDTKPYEAPEPFGERSAKAPLTQGVPWEKGKG
SEVSVMLTVSAAAAKNLNSVMVAMAELLSMKIPNSYEVLFSESPMRAAGPEAKKVETDGA
GTDKPGKPPDGNAEWLKQFDAVLPGYSLKSELDILTLLKQESPAAEKAAQHCYIHNVSNL
DVRQLSLPPEEPSPPLSPFAPSPSSPAETACIPAAEAAPEAAPVPSTPSPPAPSPAPKEE
GSLSPSRAKPRARPPEDGSGDEVRPRLKKWKGVRWKRLRFLLTIQKGGAKRDGDREIAEF
VEKLGSALRPEKVPRDLRRCCFCHEEGDGATDGPARLLNLDLDLWVHLNCALWSTEVYET
QGGALINVEVALHRGLLTKCSLCQKMGATNSCNRLRCPSVYHFACAIRAKCMFFKDKTML
CPLHKPKGPCDQELSSFAVFRRVYIERDEVKQIASIIQRGERLHMFRVGGLVFHAIGQLL
PHQMADFHSVTALYPVGYEATRIYWSLRTNNRRCCYRCTICENNGRPEFVVQVIEQGLED
LVFTDSSPQAVWNRIIEPVAMMRKDADMLRLFPEYLKGEELFGLTVHAVLRIAESLPGVE
SCTNYLFRYGRHPLMELPLMINPTGCARAEPKILTHYKRPHTLNSTSMSKAYQSTFTGET
NTPYSKQFVHSKSSQYRRLKTEWKNNVYLARSRIQGLGLYAAKDIEKHTMVIEYIGTIIR
NEVANRREKIYEEQNRGIYMFRINNEHVIDATLTGGPARYINHSCAPNCVAEVVTFDKED
KIIIISSRRIPKGEELTYDYQFDFEDDQHKIPCHCGAWNCRKWMN
NT seq 14358 nt NT seq  +upstreamnt  +downstreamnt
atggatgagcagaagccgcccagcgaggacaaagactctgaggcgccagctgacggagcc
gcgtcctcagaggagcagggcagcgcggagggagatccgctgaagcccccggaagtggtg
cctgccacgcgggagccagggagcactgagacaaagcggcccccacagccctgcagcacc
ctgccctggcgctgcgccctctgcaactgtggggactggagccggctggggcagcgggag
ctccagcgctttgagccagggcccaactggacggagcagccacaggggcaggagggccct
ggcgaggtcccggctgccgaggacgacctgtcccagatcggcttcacagaaggggtgacg
ctgagacagatctcggagccgacggggcactgctgggttcaccactggtgtgcggcctgg
tcggcgggggtgcagcggcaggacggaacagggctgaatgatgtggacaaagctgttttc
tcagggatctcgcagaaatgtgaacgctgtcagaggatgggtgctacccttcagtgccac
tcggagggctgtccgcggtgctaccacttcccctgtgcggctgctagcggctctttccag
tctatgaagaccctccagctcctgtgcccagagcacctagctgaggcggcgcagatggag
gactcgcggtgcgtggtgtgtgatgggccaggcgagctgcgcgacctgctgttttgcacc
agctgtgggctgcactaccacggcgcctgcctggagatcactgtcacgccccgcaagcgt
gccggctggcagtgccccgagtgtaaagtttgccaaacctgcaggcagcccggcgaagac
tccatgatgctggtgtgcgaggcctgcgacaagggctaccacaccttctgcatgaagcca
gccatcgagagcctccccaccgactcctggaagtgtaagaactgccgggtgtgctcagac
tgtgggcggcggccagcggctctcaaccctgcgtgccagtggtacgagaactactcggtg
tgtgaggggtgccaagagcagcggcgccgcagcacggagggcagccaggcgggtgaagcc
gaagccccaccatgcgaccagcactcaccgctgcccatggcctgcatcgactcggcgggc
ccccccgtgcccccgtcccccgcggggcacgacccacctgtgccctcacccctgccgcag
gccaggagccctgcagcagagccccaggacaagctgccagctgcggacgaagccaagccg
cccgttggcaagcaacctgggccccgccggtgggacctggtgcctggcggaggcccccgc
caaggaggaggcgatggaggtggagctggaaccaccgcccctccccgcaaccccagcgcc
ctcgcccccagcgcccccagaccttgctcccacacccccgcctcccctgcccccgggctg
gagcctgcgggcagcccctgcatctctatggacatggagcctcctgccgcctcccccgcc
ccaccgccctcaccacccgctgccgaaccgccctccgtggcgcccctgttgggctccccg
gcccacgagggagcccagcggggtagtgagggggaggagatggagacggccccggaggcc
ggggcgctggccagcccctcgggggacggagctcagcctagcccagccccggcactgggg
cccttcccgggcctggcagaggaagaggaggatgaggaagaggaggcgccgaggctggag
cgggagggggccagcgggcactgctcaccccagctgagcgaggaggacgggctggaggag
ctgcggggcgtgggggaccttgagtccagccagaccccggtcagcttcgccagcgagccc
aagggctcgcccctgctgctggagcctgaggagctgggtccggccacccccatggaggtg
tgcggggcaggcacgaagctgctgggccgcggggaggagggcggccctgagcccccggcc
ctgcaaccccgaccagccctcatcaagtcggacattgtcaacgagatttccaacctgagc
cagggtgacaccagcagcagcttccccgggtcagaacccctgctgggctcacctgatccc
gagggcgggggctcactctccatggagctgggcatgacgtccaccgatatcagcctgcag
aaggatgatgctgctctgctaccccttggcaccgactcgctacctgagacggatgactcg
ctgctttttgagccggcttctggggccaagggtgaaggagagaagggccggcggcgcagc
tcccctgggcggtccagaatcaagcagggtcgcagcagcagtttccccgggaggaggcgc
ccccgcggcgggtcccacgggggtcgtggtcgcggccgtgcccggctgaagtcaaccact
tcgtccatcgagacccttgcgctggcagatgtggacagctcccccagcaaggaggacgac
gaggaggacgaggacactatgcagaacacggttgtactcttttccaacacggacaagttc
gttctcatgcaggacatgtgtgtggtgtgcggcagctttgggcgtggggctgaggggcac
ctgctggcctgttctcagtgctcccagtgctaccatccctactgtgtcaacagcaagatc
accaaagtgatgctgctgaagggttggcgttgcgtggagtgtattgtgtgcgaggtctgt
ggcaaagcctcagacccctcacgcctgctgctgtgcgacgactgtgacgtcagctaccac
acttactgcctggacccgccgctacagactgtgcccaagggtggctggaagtgcaagtgg
tgcgtgtgctgtgtgcagtgtggggcggcctcgcccggcttccactgcgagtggcagaac
aactacacgcactgcggcccctgtgccagcctagtcacctgccccgtctgccgggagaag
tacgtggaagacgacctgctcatccagtgccgccactgtgaccggtggctccacgcctcg
tgtgacaacctcttcacggaggaggaggtggagcaggcggcagacgagggcttcgattgc
agcgcctgccagccctatgtggtcaagcctgttgtgcccgtggcccctgcagagatcacc
ccgatgaagatgaaggagccagagccccagtacttccgcttcgagggtgtctggctgact
gagactggcatggccgtgctccgcaacttgaccatgtccccactgcacaagcggaggcag
cgcaaaaccaggccaggggccctcaacggggagggcagcttggagggcagcgaccccctg
ggccccgacgagaagaaggagggggacctggaaggggatgagctgctgaaggctgaagtg
ggtgtggagcacatggagtgcgagatcaagctggaagcctctgccagccctgaccgggat
ggtggggctgacctggattcggggaaggggctggaggacctggaggagtgcaagaagagg
aagcggaagccataccgtcctgggatcggtggcttcatggtgcggcagcgcaagtctcac
acgcgtccgaagaaatgcccggctgtgctggcagaggcggggcgcgaggggctgggtgct
gagggacaccctgaggatggggtgccagcagacatcccggctgagggtgctgccgagcca
ggggtggccgagggtgatgagaagaagaagcggcggggtaggaagaagagcaaactggag
gacatgttccccccatacctgcaggaagcgttctttggcaaggcactcatggacatgagc
cggaaggccctgctggcagctggcggtgtgggtgacggagccgtccgcccctcctttggc
cagggcgccccccgacccaaggtggaccccagcgtgcccggggccctccaaggcacgccc
agagaccggaaggaggcccccactcacttgagaggggatgacagcatggatggcagcacc
atgatgggccaggaggatgactcgaaggacgcagaggcaaaagccgaggacttgggggca
gaggagccaaaggactcgccggatcccggggatgctgagaagccagcgacgccgggtgag
ggcgcgctcagctccgacctcgacaggatccccatggaagagctgcccaagatggagagc
aaggatgtgcagcagctcttcaaggatgtgctgggctccgcggagcgggagcagcagctg
aactgcgtggcagcagggctggaggccggcgtggcggggcgagaccccagccggacccag
ctcccacagaggcctttcctgcagggtgacttgcagctgcctggacagggaggtatttct
ctgggatcgatcccctccagtgtccctatggagacctattctggagtctgccagtccccc
ttcctggacaacaggnaaagaagcggcttcttcagcccagagcactgcgagccggagagt
ccctgggccagcagctctgctgccaccacaccctccacgcccacgacgcccaccacagag
ggcgagggtgatgggctgtcctacaaccagcgcagcctgcagcgctgggagaaggacgag
gagctgggcgagctctccaccatctcacccgtgctctatgccaacatgaacttccccagc
ctcaagcaggactatccagactggtccagccgctgcaagcagatcatgaagttgtggagg
aaggtgcctgccacagacaaagctccctacttgcaaaaggccaaagataatcgggcggct
catcgcatcaacaaggtgcagaagcaggctgagagccagatcaacaagcagaccaaaggg
gagggcctgcgcaagcctgagaggccctcgctgcacctgcggatcccaatgcagccgggg
gcgctgcccagctccgcccagccccccagcaccggcgggcagcctgtctacgtcaacagt
gcagccggcctgcccccctcggccgacggctttctgaagcaacctgcgggcaccggaggg
ggagccgattcgcccagtgagctcttcctcaagctcccgccccagtcccctgcccaagtg
ccttcccacgatccctacaccatggcctccacgtacccactcgagccgcgcttctcctct
cccctgggccagagtcccacagcgggctctggattccagcccttcccaccccagcccccg
cagcagctcctgcccacaccccggccagctcccggcccccagtctgagttccaccccacc
tcacccgggaccccccggcaccagccctccaccccggacacctttctgaagccccggtgc
cccagcggctccctggataacctcggcggccgcggcgccggccccccggagccgctgctc
tcacccccaccctttggggaacagaagaagggcctggatgcagcagggctgcaggtcaag
aaggaggaaggggctctgggcgtatgctctcccgggtatgccctggcctacgccgactcc
ccggccggcccccacctctctgcagacctgcacaaacccccccggccccagatgccggag
tccagctacaagacggtaccaatcccgcacagcgctccagctggagggggcttcccccca
gcacagcccgagccccatgccaaggtgccggggagccaacagccccccttcatccgctcg
cctggtgccagcgtcttccctggtgcccaggcccagatgcgcttcaccttcccaccctcg
gtcgcagagccgctcaagggctccccctcccaccagcctcatgggatgaacagccatttt
gccccgagccaggccctgggcaagccccagagcaccagctatgcctcctcgcccagcttc
caccaggccggcagccccctggggccaggcaacgccacccctgagacctacagcctctcc
ccgctgcggcccccatcggtgctcccccagcaggccccgcagcagcaggatgtcagcctt
ggctacctgcctcgaccgggcctggtgccatccaccgacaagagggaggaggttgtggca
ggcatcacggtgccccccagccgggagctgccggagctgcccgtcagccaggagggtgcc
ctcaacagcatgagccagtcggaactggagaaacagcggcagcggcagcgactccgcgag
ctgctcatccgccagcagatccagaggaacaacctgcggcaggagaaggagagtgcggcc
gccgcagccggctccaccccgacagcctggggccccgataccagctcccaggcctttgag
cagctcagccggggcatggcaccataccagcctgtgcaggacaagagcatcctggggagc
ctgcccgcagtgcctagtggtaccaagctacccggcccagccctggtgccagccgcctac
gcccaggacgagcgcctggcccggccacccccctcagccacgccctccgccatggacatc
aacggcaggacggcagtgggacccacgcagacgttctacccccgcgccgtattcccgggg
cccacaccgcagcagcagcagcagcagcagatatggcaggggcggcagcgccggggaggc
ctacctgtgtctactcgtttccagcagccgccaggccacgagctcgggcggccagtgctg
ggcccccctgtgagcgggctggcctcacgcatgccgggccctgccgagccactccctgcc
tcgcctggtgccatcgggccccagttcattgagctgcgtcacaacgtgcagaaggcggct
cccggggctgtggggccaccctttgcccagcagggcccccctgccaggccccgtttcttc
ctgcccggtgacgagacctctggcccagctgctcgcacctccatcctgcccatgcagcca
gcagtgctgggcggcccagtcttgcaaccccagaagatgccagtgcctttgccgccctct
tctgcgtcctcacagggggctgagatgagcaacagccaccacccgcctctcaccaaaggc
ccctcgctgcccctgccctcggctagcctggagctgccacatgtgccccctcgcccactg
tcgtctgctggcaccggcccacgccccgagggccccaaggatgatgctgcggcgcccgct
ccaggttcggcttcagcttccggcaggagccaactggggctgccatgtgacgtcccggta
gagcctgacttggatgacgactttgacacccacaaggacctggaggacgacgacttggcc
aacctgagcctagaccccgatgtggccaagggtgatgacgacctggatagcctggaggcc
aacgacccgcannnnnnnnnnnnnnnnnnnnnnnnnnnnntgctgaacggggatgagttt
gacctgctggcctacactgaccccgagctggacaacggtgacaagaaggacatcttcaat
gagcacctgcgcctggtggagtcggccaatgagaaggctgagcgcgaggccttgctgaag
acagagccgcccacgtctggcccaagggtccccaatgctggggagcgcaaggaggttgca
ccgcctgggagggaaagggtggtggtcaaggaggggccagctccgggcatggggttgtcc
tctgcctcctgcccctctgggcccgtgccagcccctgaccccgccttcaaggcacagggc
agtgtcctggaggccaagatgggcccactgccggcagacatcaagcccaaactggaggaa
ggctgcttgaagacgtcaccctgccagtttactaccagcggccctgaccggctcccgggc
cccatcaaggctgaggctctccagggagctgagagagtggctgctaccctcgggctgaac
ctcaagccaggccaggccctcctgagtcagggtgcagggccagcgcggctcagcatgggc
catttccctgacaaaggccaccctgccgcccctggctcggacaaggacccttatgctggc
cctgggcgtgggctggcgcctggccaggtagccccaccaggcagcgccttgctggagaag
tttgagttggacggaggtgccttgggcctggccaacacccagcactcaccaggtgatgat
ctggacaaaatggagagttccctggtggccagtgagctgccgctgctcattgaggaccta
ctggagcacgagaagaaggagctacagaagaagcagcaactgtcagcccagctgcccagc
ggcactgcacctctgcagccctcgcatgccatgctgccggcccagccccagccccacgac
acgcaggctccccgcctggtggggccacagatgcagctgggcctggtcgcacggcagcag
ggcctggtagccccccagcagctgatggcacagcagcagccgcagcagcgcctggcagga
gccccacagggccagggccagggcccccacatggcactagcgcagcccccacctcatgca
cttgtggcctcctctgctgtccctgcagccctggcccagcagaagcagctggctggggtg
cagccctccagcctgggcctgaagcagcagcagcttgtcctgcagcagcagcagcaggag
caggagcacggctccttcctcgcagacctagataagtttgcagctgaggacatcatggac
cccatcgccaaggcaaagatggtggcgctgaagggcatcaagaaggtgatggcacagggc
agcattggcgtggcccccggcatgaacaggcaacaggtgtccctgctggcccagcggctg
tcaggagccccagccacggctgagatgcagaaccatatcctgactgggagtgggcaggag
cggagcagcactgacccagcccaggctcgccccaaccccccgacctttgctcagggcgtt
atcaacgaggccgaccagcggcagtacgaggagtggctcttccacacgcagcagctgctg
cagatgcaactcaaggtgctggaggagcagattggtgtccaccgcaagtcccgcaaagcg
ctgtgcgccaagcagcgcaccgccaaaaaggctgggcgggagtttcctgaggccgatgct
gagaagctcaagctggtcacggaacagcagagcaagatacagaagcagctggaccaggtc
cgcaagcagcagaaggagcacaccaacctgatggctgagtaccgcaacaagcagcagcag
caccagcagagctcggctgtgctggccctcagcccctcgcagagcccgcgcctcatggcc
aagctccccgggcagctgctgccagcgcatggtgtccaaccatccctgtcccagccagga
gccaccatggtgggcgccccaggcctgggccaatcccaaggacagctggtggggcaggcg
gctggcctgcgccctccccaaggcagcagcggagtccctatggcagtccagcaaggcctg
tcgttcatgggccagcagcagctggggaatgcggccgtgcctgggacctccaacagcttc
ttcccaggcccggggggccagactatggtcccaaagcagcaaggattgatgggaaaccag
cagggcatcctggtgcagcagctctccccgcagcagccgccgcaaccaggcatgcagggg
caccccccagcgcccacgctgcagcaccaggggaagggccaccagccacgccagctgctg
ctggccccccaccagcagagggtgctggggtcgccccagctggggcagcaggcgcctggc
ctcctggggcaccgcctcgtcctgtcccagcagcagcagcagcaggtcgggctcctgggg
ccggcacggacactgctgacgccacagcagcagaactctctagcacagcaccagcctggt
gccctgctgcaccagcccctgcctggtgacccgacagcaggagctgccaggcaggacaca
ccacagctgcacgcgaatcccagcccggggccaccccagccgggcttgccagtatcggag
ccaccgcagagctgtgccatgagccaggcacaaagcatcatggtgcagcagcagcagcaa
aggattgtggggcacccccagctgccctcacggctgcagagcatggtggggccaccccga
cctgggctgcagcagcagggcctgctgctcccgcctgcagcccatgcgcagagcctgctg
ggccaggtgccggggccagtgctggggcagatccgggcgcagctgcagggtgtgctggcc
aagaacccgcagctgcggcacctcacaccacagcagcagcagcagctgcaggccctgctc
gtgcagcgccaccagcagaacctgctgcagcacagccaggcactgcgccaggccggcccc
ttcccagggcaggagtccgggcagccaggcacggctccccatgcccctccacctgccccg
ccccgccagctgggcactctcttccaggtgcgctcagctggcccggttcctgagccgggg
cttggcatggagcgggtgcctgcaggggccccccacccgcagccgctggcagagctggtc
catggcggtcgcagcccccagccagccatgctacgactgtccaccacatcggcacccccc
accatccagtcgcccctaagtgtgctcagcctgggccccgcaccaccacagcaccctgtg
cccagcccagaacagggcacccaagagccaaagaaagcctccccttccctcctggcacag
acccctgtagccctgccggagcagcggccagcacccccccacagtgggctcctgcctgag
ccacccaagcctgacccctctcctgctccccccaagccaacctccagccagagcagggag
gagcccttcccagtgccccccagcccttgggatcccgcggcacaggggcccattgctcct
cctggtacggagcccgcgaaggcacgcctgcccatggtccccatcagtgggcaggcacct
gaagtgccccgcacagagactttgctgcctgaagctggggggccactggccatgccccct
ggagtgtgcgtcaagcaggagcccaaggaggagggagtgccgtgtgagctagctgcggag
cagctcctgaagcctgaggcccacagggagcagccggcagcacccaccccggccaaccac
cacctgctgggcagccagctgctggcgggtgcccccccagaggctgggcacctgctgctg
cagaagctgctgcgggccaagaatgtgcagctggtatcacagcgcactgccgaggggctg
caccctgagctcaacgggcatgctgatggcaagctggccgcgctggagcacaggctgcag
gctgtggccccaggcagggaggacccatctgccgccaagaagctgctggccccaaagccc
aagcgggtgcagaagggcaatgagcgggtccccacctcccgcaagaagctgcgcaaggat
gatggcctgaagcccagtgaggccctcatgaagcaactgaagcaggagctctccctcctg
cccctgatggagccgaccatcacggccaacttcagcctcttcccgccctttggcagcagc
cccatcaatggccggagccctctcaagggtgccttcggcagcgctgttctggaaagcgtc
cccgactactactcccagctactatccaagaacaacctgagcaacccaccaacgccgccc
tcatcgctgccccccaccccgcccccctcggtgcagcagaagatggtgaatggtgtcacc
tccggcgaggagttgcctgagcagcccaaggacccggcccgtgagcccgagggccacaag
gatgctcctgccgtggaagtgaagagcttggacctgctggcggccctacccacaccaccg
cacaaccagactgaggatgtccggatggagagcgatgaggagagtgactcccccgacagc
atcgtgcctgcctcgtccccggagagcatccttggggaggatgtgccccgctttcccctg
ctgacggagacgcggccggagctggaagagcgcgtgctgtcccccgtcatccccatcatt
cccagggccagcatcccagccttccctgacaccaagccctacgaagcaccggagcccttt
ggggagcgctctgcgaaggccccgctgacgcagggagtcccctgggagaagggcaagggc
agtgaggtctccgtcatgctgaccgtctctgctgcagcagccaagaacctgaacagcgtc
atggtggccatggccgagctgctgagcatgaagatccccaactcctatgaggtgctgttc
tctgaaagccctatgcgggccgctgggcccgaggccaagaaggtggagactgatggagcc
ggcactgacaaacctgggaagccgcctgacggcaatgcggagtggctgaagcagttcgac
gccgtgttgccaggctacagcctcaagagcgagctggacatcctgacacttctcaaacag
gagagcccggcagcagagaaggcggcacagcactgctacatccacaacgtgtccaacctg
gacgtgcggcagttgtcactgccacccgaggaaccctcgcccccgctttcccccttcgcc
ccatcgccctccagccctgccgaaaccgcctgcatcccggctgccgaggccgcccctgag
gcagcaccagtgccctccactccatccccacctgccccttccccagcccccaaggaggag
gggtcactctcgccatcccgggccaagccacgcgcacggcctccggaggatggcagtggg
gatgaggtgcggccgcggctgaaaaagtggaagggggtgcggtggaagcgtctgcggttc
ctgctcaccatccagaaaggtggggccaagcgagatggcgaccgggagatcgctgagttt
gtggagaagctgggctcagccctgcggccagagaaggtgccgcgggacctgcggcgctgc
tgcttctgccatgaggagggcgatggtgccacggacggccctgcccgcctcctcaacctg
gacctggatctctgggtgcacctgaattgcgccctgtggtccacagaggtgtatgagacg
cagggcggggccctcatcaatgtggaggtggcgttgcaccgggggctgctgaccaagtgc
tccctgtgccaaaagatgggtgccaccaacagctgcaaccgcctgcgctgccccagcgtc
taccactttgcctgcgccatccgcgccaagtgcatgttcttcaaggacaagaccatgctg
tgccccctgcacaagcccaagggcccctgcgaccaggagctgagctcctttgccgtcttc
cggcgcgtctacattgagcgcgacgaggtcaagcagattgccagcatcatccagcggggc
gagcgcctgcacatgttccgcgtgggtggcctggtcttccacgccatcggccagctgctg
ccccaccagatggccgacttccacagcgtcacggccctctaccccgtgggctacgaggcc
acacgcatctactggagcctgcgcaccaacaaccggcgctgctgctaccgctgcaccatc
tgcgagaacaacgggcgccctgagtttgtggtgcaggttatcgagcaggggctagaggac
ctggtcttcactgattcctcgccccaggccgtgtggaaccgcatcattgagccggtggcc
atgatgaggaaggacgctgacatgctgcggctgttccctgagtacctgaagggggaagag
ctcttcggcctcacggtgcacgccgtgctgcgcatcgccgagtctctgcctggcgtcgag
agctgcacaaactacctgttccgctatgggcgccatccgctaatggagctgccactcatg
atcaaccccactggctgcgcccgggctgagcccaagatcctcacccactacaagcggccc
cacaccctgaacagcacgagcatgtccaaggcctaccagagcaccttcacgggcgagacc
aacacgccctacagcaagcagttcgtgcactccaaatcctcacaatatcggcgcctcaag
accgagtggaagaacaacgtttacctggcgcgctcccgcattcaggggctggggctgtat
gcagctaaagacatcgagaaacacaccatggtcatcgagtacatcggcaccatcatccgc
aacgaggtggccaaccggcgcgagaagatctatgaagagcagaaccgagggatctacatg
ttccgcatcaacaacgagcacgtcatcgacgccacgctgacggggggcccggccaggtac
atcaatcactcatgcgccccaaactgcgtggccgaggtggtgaccttcgacaaggaagat
aagatcatcatcatctccagccgccgcatccccaaaggggaggagctgacctacgactac
cagttcgacttcgaggatgatcagcacaagatcccctgccactgcggagcctggaactgc
cggaagtggatgaactag

DBGET integrated database retrieval system