KEGG   Alligator sinensis (Chinese alligator): 102373438Help
Entry
102373438         CDS       T02922                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00010  Glycolysis / Gluconeogenesis
asn00053  Ascorbate and aldarate metabolism
asn00071  Fatty acid degradation
asn00280  Valine, leucine and isoleucine degradation
asn00310  Lysine degradation
asn00330  Arginine and proline metabolism
asn00340  Histidine metabolism
asn00380  Tryptophan metabolism
asn00410  beta-Alanine metabolism
asn00561  Glycerolipid metabolism
asn00620  Pyruvate metabolism
asn01100  Metabolic pathways
Module
asn_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102373438 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    102373438 (ALDH2)
   00620 Pyruvate metabolism
    102373438 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    102373438 (ALDH2)
   00561 Glycerolipid metabolism
    102373438 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    102373438 (ALDH2)
   00310 Lysine degradation
    102373438 (ALDH2)
   00330 Arginine and proline metabolism
    102373438 (ALDH2)
   00340 Histidine metabolism
    102373438 (ALDH2)
   00380 Tryptophan metabolism
    102373438 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102373438 (ALDH2)
Enzymes [BR:asn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     102373438 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 102373438
NCBI-ProteinID: XP_025054582
UniProt: A0A3Q0G563
LinkDB All DBs
Position
Unknown
AA seq 545 aa AA seqDB search
MLHFPDSCDLKTWERRERVAGFARHGAHVRGSCLRRHQTNTESFQILLGSGSRARTLVTN
VFFSLQIFINNEWHDAVSKKTFPSINPATGEVICQVAEGDKADVDKAVSAAKAAFQLGSP
WRRMDASHRGKLMNRLADLIERDRAYLAALETLDNGKPYSIAYLVDLDMTVKCLRYFAGW
ADKCHGKTIPVDGDYFCYTRHEPVGICGQIIPWNFPLLMQAWKLGPALATGNVIVMKVAE
QTPLSALYVASLIKEAGFPAGVVNIVPGYGPSAGAAISSHMQVDKVAFTGSTEVGHLIQK
AAAESNLKKVTLELGGKSPNIILSDADMDWAVEQSHFALFFNQGQCCCAGSRTYVQEDIY
HEFVERSVERAKARVVGNPFDFKTEQGPQVDEEQFKKILGYINIGKREGAKLLCGGNPAA
DRGYFIQPTIFGDVQDKMTIATEEIFGPVMQILKFKTVEEVIERANDSKYGLAAAIFTKD
IDKANYVSQALRAGTVWINCYDVFGAQAPFGGYKESGNGRELGEYGLEAYTEVKTVTIKI
PQKNS
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgttacactttccagattcttgcgacttaaaaacatgggagaggagggagagagttgct
gggtttgcaaggcatggtgcccatgttcggggctcctgtttaagacggcaccaaacaaat
acggagagcttccagattctgcttggatctggctccagggctcgaacgcttgtcacaaat
gtctttttttcactacagattttcatcaacaacgaatggcatgatgcagtcagcaagaag
actttcccttccatcaacccagccacaggggaggtgatttgccaggttgctgagggtgac
aaggcggatgtggacaaagccgtgagcgcggccaaagcagctttccagctgggctcgcca
tggaggcggatggatgcatctcaccggggaaagctgatgaaccgtcttgcagacctgatt
gagagagaccgggcttacttggctgccctggaaactctggataatggcaaaccatactct
atcgcctacttggtggatttggacatgacagtcaagtgtctcaggtactttgcaggctgg
gctgataagtgccatggcaaaaccattcccgtagatggagactacttctgttatacaaga
catgagccagttgggatctgcgggcagatcatcccgtggaacttcccgctgctgatgcag
gcatggaaacttgggccagccttagccactgggaatgtgattgtgatgaaagtagctgag
caaacgcccctgtctgctctctacgtggccagtctgatcaaagaggctgggttccccgca
ggcgtggttaatattgttccgggctatgggccgagtgcaggagctgccatttcatcccac
atgcaggtggataaagtggccttcacaggctccactgaggttgggcatctgatccagaag
gctgcggcagagagtaacttaaagaaagtgacgctggagcttggagggaagagcccaaac
atcatcttgtctgacgctgacatggactgggcggttgagcaatcccacttcgccttgttc
ttcaatcaagggcagtgctgctgtgctgggtctcggacatatgtccaagaagatatatat
catgagtttgtggagaggagtgttgagagagcgaaagccagagtggttggaaacccgttt
gacttcaaaactgaacagggaccgcaggtagatgaggagcagtttaagaagatccttggt
tacatcaatattgggaagcgtgaaggagccaagctgttgtgtggtggcaaccctgctgca
gacagaggctattttatccagccaaccatctttggagatgtgcaggacaaaatgaccatt
gctacagaggagatatttgggccagtcatgcagatcttgaagttcaaaactgttgaggaa
gtcattgagagagcaaacgactctaaatatggcctggcagcagctatcttcacaaaagat
atcgacaaagcaaactacgtgtctcaagcactgcgagctggaactgtctggatcaactgt
tatgatgtatttggagctcaagccccgtttggtgggtacaaagaatctgggaatgggcga
gagctaggggagtatggcctggaggcatatacagaagtgaaaacggtaacaatcaaaatc
ccacagaagaactcgtaa

DBGET integrated database retrieval system