KEGG   Alligator sinensis (Chinese alligator): 102374249
Entry
102374249         CDS       T02922                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X2
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
asn00230  Purine metabolism
asn01100  Metabolic pathways
asn04020  Calcium signaling pathway
asn04114  Oocyte meiosis
asn04261  Adrenergic signaling in cardiomyocytes
asn04270  Vascular smooth muscle contraction
asn04371  Apelin signaling pathway
asn04540  Gap junction
asn04912  GnRH signaling pathway
asn04914  Progesterone-mediated oocyte maturation
asn04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:asn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102374249 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    102374249 (ADCY3)
   04020 Calcium signaling pathway
    102374249 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    102374249 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    102374249 (ADCY3)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    102374249 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    102374249 (ADCY3)
   04916 Melanogenesis
    102374249 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102374249 (ADCY3)
   04270 Vascular smooth muscle contraction
    102374249 (ADCY3)
Enzymes [BR:asn01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     102374249 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA
Other DBs
NCBI-GeneID: 102374249
NCBI-ProteinID: XP_006029307
UniProt: A0A1U7SCA0
LinkDB
Position
Unknown
AA seq 1124 aa
MPRNRAFSEPEYSAEYSADYSVSLPSDPEHGVGRTHEVTVRSSGSCLCLPRFMRLTFAPE
SLENLYQTYFRRQRHETLLVLVVFAALFDCYVIVMCAVVYSPDKLAPTLVASVGLALQVL
LFVLCRYRLLPDRVSRKFMPYVLWLLIVAQIFCYLGLNFARFHEASDTVGWQAFFVFSFF
ITLPLSLTPIVLISAVACGIHTLVLGVTIAQQQQDSLDGGALLRQILSNVAIYLCTITVG
IMSYYMADRKHRKAFLEARQSLEVKLNLEEQSQQQERLMLSILPKHVADEMLKDMKKDAS
QKEMQQFNTMYMYRHENVSILFADIVGFTQLSSSCSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTNVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQNTMDCLKGEFEVEPGDGGSRCD
YLKEKGIVTYLVLVPKQPLKNGINGVKLSLTSSHGNSPLLINTKECNGSINTTCTTPDEG
EEIDARGNGAEEEGEVVNPSFPNPRRRLRLRDLAERVIDASENEQELNKLLNEALLERES
VQALKGKNTYRLSMRFIDPEMETRYSVEKEKQSGAAFSCSCVVLFFTALVEILIDPWLVA
NYVTFVIGEILLLILTICSLAAIFPRVFPKKLVAFSTWIDRTRWARNTWAMSAIFILTMA
DIVDMLSCLQYYTGPSNVTVTTLLAGGCVENPKYYTYIAVLALIATIMLVQVSHMVKLTL
MVMITSAVGVVNIYAWAQIFDEYDQHRFKDYVSSQLPSKYSMTVMVFIMMLSFYYFSRHV
EKLARTLFLWKIDVHDQKERVYEMRRWNEALVTNMLPDHVARHFLGSKKRDEELYSQSYD
EIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDALLDEPQFRCITKIKTIGST
YMAASGVTPDANSNGYNTTKKENLSDKERWQHLADLADFALAMKVTLMNINYQSFNNFML
RIGMNKGAVLAGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQVVEETHVILKEYGFRF
VRRGTIFVKGKGELLTFFLKGREKQGSFINGSSITLPHQVVDSS
NT seq 3375 nt   +upstreamnt  +downstreamnt
atgcccaggaacagggccttctccgagcccgagtactcggcagagtactcggcggactac
tcggtcagcctgccctccgaccccgagcacggggtgggccggacccacgaggtgacggtg
aggagctcgggctcctgcctgtgcctgccacgcttcatgcgcctcaccttcgcccccgag
tccctggagaacctctaccagacctacttccgccggcagcgccacgagaccctcctggtg
ctggtggtcttcgcggccctcttcgactgctacgtcatcgtcatgtgcgccgtggtctac
tccccggacaagctggcccccacgctcgtggcctcggtgggcctggctctgcaggtcttg
ctcttcgtcctctgcaggtaccggctcttgccggaccgcgtctcccgcaagttcatgccc
tacgtcctctggctcctcatcgtggcccagatcttctgctacctgggcctcaacttcgcc
cgcttccacgaggccagcgacacggtgggctggcaggccttcttcgtcttctccttcttc
atcaccttgcccctcagcctcacgcccatcgtcctcatcagcgccgtggcctgcggcatc
cacaccctggtgctcggggtcaccatcgcccagcagcagcaggactccctcgacggaggg
gccttgctccggcagatcctgtccaatgtggccatctacctgtgcaccatcaccgtgggc
atcatgtcctactacatggccgaccgcaagcaccgcaaagcctttctggaagcacggcag
tccttggaggtcaagctgaacctggaggagcagagccagcagcaggaacggttgatgctt
tccatcctgcccaagcacgttgcggacgagatgctaaaggacatgaagaaggacgcgagc
cagaaggagatgcagcagttcaacaccatgtacatgtaccgccacgagaacgtcagcatc
ctgttcgctgacatcgtcggcttcacccagctgtcgtcgtcctgcagcgcccaggagctg
gtgaagctgctgaacgagctctttgcccgctttgacaagctggccgcgaaataccaccag
ctgcgcatcaagatcctgggagactgctactactgcatctgcgggctgcccgactaccgg
gaagaccacgccgtctgctccatcctgatgggactggccatggtggaagccatctcctac
gtgcgagagaagaccaaaaccaacgtggacatgcgtgtgggggtccacaccggcacggtg
ctgggcggggtgctgggccagaagcgctggcagtacgacgtgtggtcgacagacgtaacg
gtggcaaataagatggaggctggcggcatccctgggcgagtgcacatctcccagaatacc
atggactgcttgaagggcgagttcgaagtagagccgggagacggcgggtcgaggtgcgac
tacctgaaggagaaggggattgtcacgtacctggtcttggtgcccaagcagcccctcaag
aacgggatcaatggcgtgaagctgtccctgacgtcgtcgcacgggaactcgccgctgctg
atcaacaccaaggagtgcaacggcagcatcaacaccacgtgcaccacacctgacgagggc
gaggagatagatgcccgcgggaacggcgcggaggaagagggcgaggtggtgaacccatcc
ttccccaacccgcggcggcgcctgcggctgcgcgacctggccgagagggtcatcgacgcc
tcggagaacgagcaggagctcaacaagctgctcaacgaggctctgctggagagggagtcc
gtccaggcgttgaaggggaagaacacgtaccgcctgtccatgcgtttcatcgaccccgag
atggagacgcgctactccgtggagaaggagaagcagagcggggccgccttcagctgctcc
tgtgtcgtcctcttcttcactgccctggtggagatcctcatcgacccctggctggtggcc
aattacgtgacattcgttatcggggagatcttgctgctgatcctgaccatctgctctctg
gctgccatcttccccagggtgttccccaaaaagctcgtggccttttccacgtggatcgac
aggacccgctgggcccggaacacgtgggccatgtccgccatcttcatcctcaccatggcc
gacatcgtggatatgctcagctgcttgcagtactacactggtcccagcaatgtcacggtg
acgaccctgctggcgggcggctgcgtggagaaccccaagtactacacctacatcgccgtg
ctggccctcatcgccaccatcatgctggtgcaggtcagccacatggtcaagctgaccctg
atggtcatgatcaccagtgctgtgggcgttgtcaacatctatgcctgggcacagatcttc
gacgagtacgaccagcaccgcttcaaggactacgtgtcctcgcagcttccctccaagtac
tccatgacagtgatggtcttcatcatgatgctcagcttctactatttctctcgccatgtg
gagaagctggccaggaccctgttcctgtggaagatcgacgtgcacgaccagaaggagcgg
gtgtacgagatgcggcgctggaacgaggcgctggtcaccaacatgctgccggaccacgtg
gccaggcacttcttgggctccaagaagcgggatgaggagctgtacagccagtcctacgac
gagatcggcgtcatgttcgcctccctgcccaacttcgctgacttctacacggaggagagc
atcaacaacggcggcatcgagtgcctgcgcttcctcaacgagatcatctctgacttcgac
gcgctcctggatgagccccagttccgatgcatcaccaagatcaaaaccatcggcagcacc
tacatggcggcctccggagtgacccctgatgccaacagcaatggctacaacaccaccaag
aaggagaacctgtcagacaaggagcgctggcagcaccttgccgacctggcggacttcgcc
ttggccatgaaagtgaccctgatgaacatcaactaccagtctttcaacaacttcatgctc
cgcataggcatgaacaaaggggcggtgctggcaggtgtgatcggcgcacgcaagccccac
tacgacatctggggcaacacggtgaatgtcgccagcaggatggagtcaacgggcgtcatg
ggaaacatacaggtggtggaggagacccacgtcatcctcaaggagtacggcttccgcttc
gtgcgccgcggcaccatcttcgtcaagggcaagggggagctgctgaccttcttcctcaag
ggccgcgagaagcagggctccttcatcaatggctcctccatcacgctgccccaccaggtg
gtcgacagctcctga

DBGET integrated database retrieval system