KEGG   Alligator sinensis (Chinese alligator): 102374457Help
Entry
102374457         CDS       T02922                                 

Gene name
ACE
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Brite
KEGG Orthology (KO) [BR:asn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:asn01002]
    102374457 (ACE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:asn04147]
    102374457 (ACE)
   04090 CD Molecules [BR:asn04090]
    102374457 (ACE)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     102374457 (ACE)
Peptidases [BR:asn01002]
 Metallo Peptidases
  Family M2
   102374457 (ACE)
Exosome [BR:asn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102374457 (ACE)
CD molecules [BR:asn04090]
 Proteins
  102374457 (ACE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 DUF3853
Motif
Other DBs
NCBI-GeneID: 102374457
NCBI-ProteinID: XP_014372471
UniProt: A0A1U8CWV0
LinkDB All DBs
Position
Un
AA seq 1156 aa AA seqDB search
MPPLLRLLLLFLSPAAALEASLLPPESDPTEQGAVLFADKYNSTAEIVLFKSVNASWNYN
TNLTDFNSNLQIMASLEEQNFTEAWGKKAKELYGPIFRNFTDLQLKKIIGSIQTLGPSNL
PMNKREQYNTILSEMDNIYSTAKVCPPHQMSNCWSLEPEVSDIMANSRSYKKLLYAWEGW
HNSAGNPLRPKYEEFVKLSNEAYRMDNFADTGAYWRSWYDSPTFEDDLEQLYHQLEPLYL
NLHAFVRRKLYDRYGAKYINLKGPIPAHLLGNMWAQQWNNIYDMMIPYPNKPNLDVTNAM
NQKNWNATHMFRVSEEFFTSLGLLGMPPEFWAESMLEKPMDGREVVCHASAWDFYNRKDF
RIKQCTTVTMEQLFTVHHEMGHVEYYLQYKDQPVTFRSGANPGFHEAIGDVMGLSVSTPS
HLKKIGLLDQVVQDTENDINYLLKMALEKIAFLPFGYLIDQWRWNVFSGHTSPNRYNYDW
WYLRTKYQGICPPIARNETNFDPGAKYHIPANTPYIRYFVSFILQFQFHKALCQAANHTG
PLHTCDIYQSKEAGTKLSEMLKVGSSKPWQEILFTMTGTRSMDAGALLDYFKPVTEWLEQ
QNNKTQETLGWPDFEWRPPVPEGYPEGIDKIADEAQAKEFLAEYNQTAEVVWNAYTEASW
TYNTNITDHNKQIMLEKNLLMSNHTLQYGMKARQFDYSDFQDQSMKRILKKLSDIERAAL
PKDELEEYNKLLSDMETTYSIAKVCKENDKCYPLDPDLTNILATSRDYDELLFAWKGWRD
ASGNQIRTKYKRYVELSNKAARLNGHADNGAFWRSLYETPTFEEDLEKLYLQLQPLYLNL
HAYVRRALYNKYGKEYINLKGPIPAHLLGNMWAQSWSAIFDLLTPFPSATKVDATPAMKS
QNWTPKRMFQESDNFFTSLDLIPMPQEFWDKSMIEKPSDGREVVCHASAWDFYNRKDFRI
KQCTVVNMDDLITVHHEMGHVQYFLQYKDQPISFRDGANPGFHEAIGDVMALSVSTPKHL
HSINLLPQAEDNMESDINYLMSIALDKIAFVPFGYLMDQWRWKVFDGRIKEDEYNQQWWN
LRLKYQGLCPPVPRSEADFDPGAKFHIPANVPYVRYFVSFVIQFQFHQALCKAAGHTGPL
YKCDIYKSKEAGTLLG
NT seq 3471 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcttttaaggctcctgctgctgttcctcagcccggctgctgccttggaagcc
agtctcttgccccctgagagtgaccccaccgagcaaggggctgtcttgtttgcagataag
tacaacagcacagctgagatagtcctgttcaagagtgtgaatgccagctggaattacaat
accaacctgaccgacttcaactccaacctgcagatcatggcctcgctggaggagcagaat
ttcacggaggcctggggcaagaaagccaaggaactctatggccccatcttcagaaatttc
acagacctacaactgaagaaaatcattggctccatccagaccttggggccttccaacctg
cccatgaacaagcgggagcagtacaacaccattttgagtgagatggacaatatctattcc
actgccaaggtgtgtcctccacaccagatgtccaactgctggtcattggaaccagaggta
tctgacatcatggccaattcccgcagctacaagaagctgctgtatgcctgggaggggtgg
cacaactctgctggcaaccccctgaggcccaagtatgaggagtttgtgaagctgagtaac
gaagcctacaggatggacaattttgcagacactggtgcttactggcgctcctggtatgac
tcacccacttttgaggatgatctggaacaactctaccatcagctggaacccctctacctg
aacctgcacgctttcgtcaggaggaagctgtatgaccgctatggtgccaagtacatcaac
ctcaagggacccatccctgctcatttgctgggcaacatgtgggctcaacagtggaacaac
atctatgacatgatgatcccctacccaaacaagcccaatctggatgtcacaaatgccatg
aatcagaaaaactggaatgccacgcacatgttccgggtctcagaggagttcttcacttcc
ctggggcttctggggatgcccccggagttctgggccgagtccatgctggagaagcctatg
gatgggcgggaggtggtgtgccatgcctcagcctgggacttctacaaccgcaaggatttc
aggataaagcagtgcaccacagtcaccatggagcagctcttcaccgtgcatcacgaaatg
gggcatgttgagtactatctgcagtacaaggaccagcctgtcaccttccgcagcggggcc
aaccctggcttccatgaggccattggagatgttatgggcctgtcagtctccaccccaagc
catctcaagaagatcgggctccttgaccaggtcgtccaggatacagagaatgacatcaat
tatctgctaaaaatggccctggagaagattgccttcctgccctttgggtaccttattgac
cagtggcgctggaacgtcttcagtgggcatacctcaccaaaccgctacaactatgactgg
tggtacctgagaacaaaatatcagggaatatgtcctcctattgcaaggaatgaaaccaac
tttgatcctggtgcaaagtatcatatccctgccaacacaccctacatcagatactttgtg
agcttcatcctgcagttccagttccacaaggccctgtgccaagctgccaatcatacgggc
cccctgcacacctgtgacatctaccagtccaaagaagctggaacaaaactcagtgagatg
ctgaaagttggttcttccaagccatggcaagaaatcctgttcactatgactggcaccaga
agtatggatgctggggcactgttggactacttcaaacctgtgacagaatggctggagcaa
cagaacaacaagacccaggaaaccctgggctggccagactttgagtggcgcccgcctgtt
cctgagggctaccctgagggcattgataaaatagcggatgaagcacaagctaaagaattc
ttggcagagtacaaccaaacagctgaagtggtgtggaatgcctacaccgaagcatcctgg
acatacaacaccaacatcactgaccacaataagcagatcatgctggaaaagaacctgttg
atgtccaatcacaccctgcagtatggcatgaaggcccggcagtttgactactccgacttt
caggaccagagcatgaagcgcatccttaagaagctgagcgacattgagagggctgcattg
cccaaggatgagctggaggagtacaacaaacttctctcggacatggagaccacatacagc
atagccaaggtctgcaaggaaaacgacaagtgctatccactggatcctgaccttaccaac
atcctcgccacctcaagggattatgatgagctccttttcgcctggaagggctggcgggat
gcctctgggaatcaaatcagaaccaaatacaagagatatgtggagctaagcaacaaggca
gccagactcaatggtcatgctgacaatggtgccttctggagatccctctatgaaacaccc
acctttgaagaggacctagagaagctctacctgcaactgcagcccctgtacctcaacctt
catgcctatgtgcgccgagccctctacaacaaatatgggaaggagtacatcaacttgaag
ggccccatcccagcccacctgctaggaaacatgtgggcccagtcatggtctgccattttt
gatctgctgacacctttccctagtgccaccaaagtggatgccaccccagccatgaaaagc
cagaactggacccccaagaggatgtttcaggagtcagacaatttcttcacctctctggac
ttgatccctatgccccaggaattctgggacaagtccatgattgagaagccatcggatggg
cgggaagtggtgtgccatgcctcagcctgggacttctacaaccgcaaggacttcaggatt
aagcagtgtacggtggtgaacatggatgacctgatcactgtgcaccatgagatgggccac
gtccagtacttcctgcagtacaaggaccagcccatatctttccgtgatggagccaaccct
ggcttccatgaggccattggggatgtcatggccctgtcagtctccacccctaagcacctg
cacagcatcaaccttcttcctcaggctgaggataatatggagagcgacatcaattacctg
atgagcattgccttggacaagattgcctttgtgccttttggctaccttatggaccagtgg
aggtggaaggtgtttgacgggcggataaaggaagatgaatataaccaacagtggtggaac
ctcaggttgaaataccagggcttgtgcccacctgtgcccaggtcagaagctgactttgat
cctggtgccaagttccacatccctgccaatgtgccgtatgtcaggtactttgtcagcttt
gtgattcagttccagttccaccaagccctctgcaaagcagctggacacactggccccttg
tacaagtgtgacatctacaaatccaaggaggcagggaccctcctggggtga

DBGET integrated database retrieval system